KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4308Help
Entry
Rahaq2_4308       CDS       T01770                                 

Definition
(GenBank) alternative sigma factor RpoH
  KO
K03089  RNA polymerase sigma-32 factor
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:raq03021]
    Rahaq2_4308
Transcription machinery [BR:raq03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Rahaq2_4308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r1_2 KORA IF2_N HTH_10 UCR_14kD SANT_DAMP1_like HTH_3
Motif
Other DBs
NCBI-ProteinID: AEX54061
UniProt: H2IWL2
Position
complement(4586339..4587196)
Genome map
AA seq 285 aa AA seqDB search
MTKEMRTLALVPQGSLEAYVRAANAYPMLTAEEERALAERLHYNGDLEAAKELILSHLRF
VAHIARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKNKQRLGWFSHDEVEHVARELGVTSKDVLEMESRMAAQDM
TFDPTPDDEPRDGAAMAPMLYLQDKSSDFAETIEEDNWDQDATDKLSYAMEGLDERSQDI
IRARWLDDDNKSTLQELADKYGVSAERVRQLEKNAMKKLRMAIEA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaaatgcgcactttagcattagtaccccaaggtagcctggaagcctatgtt
cgggcagccaatgcctatcctatgcttaccgcagaggaagaacgggcgctggctgaacgg
ctgcattacaacggtgacctggaagcagcgaaagagctgatcctgtctcacctgcgcttt
gttgctcacattgcccgcaactattcaggctacggtttgccacaggcagaccttatccag
gaagggaacatcggcctgatgaaagcggtacgtcgctttaatccggaagtcggtgtgcgt
ctggtatcctttgccgtgcattggatcaaagcagaaattcacgaatatgtgctgcgtaac
tggcgcatcgtgaaagtcgctaccaccaaagcgcagcgtaagctgttcttcaacctgcgt
aaaaacaaacagcgtctgggctggttcagccacgacgaagtcgagcacgtcgcccgcgaa
ctgggtgtgaccagcaaagatgtgctggaaatggaatcacgcatggccgcacaggacatg
acgtttgatccgacgccggatgatgaaccacgcgacggcgcagcgatggcaccgatgttg
tatctgcaagataaaagttccgactttgcagaaaccatcgaagaagataactgggatcag
gacgcgaccgataaactttcctatgcaatggaaggtctggacgaacgcagccaggatatc
atccgcgcacgctggttagacgatgataacaaatcgaccctgcaggaactggccgacaaa
tacggtgtttccgcagaacgtgttcgtcagctggaaaagaatgcgatgaaaaaattgcgt
atggcgatcgaagcctga

DBGET integrated database retrieval system