KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4310Help
Entry
Rahaq2_4310       CDS       T01770                                 

Definition
(GenBank) cell division ATP-binding protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02010  ABC transporters
Module
raq_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:raq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rahaq2_4310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:raq03036]
    Rahaq2_4310
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raq02000]
    Rahaq2_4310
Chromosome and associated proteins [BR:raq03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Rahaq2_4310
Transporters [BR:raq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    Rahaq2_4310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 RsgA_GTPase AAA_23 AAA_22 AAA_30 AAA_25 MMR_HSR1 NTPase_1 AAA_33 SMC_N
Motif
Other DBs
NCBI-ProteinID: AEX54063
UniProt: H2IWL4
Position
complement(4588497..4589159)
Genome map
AA seq 220 aa AA seqDB search
MIRFEQVSKAYLGGRQALQGVNFHIQQAEMAFLTGHSGAGKSTLLKLICGIERPSAGHIL
FGGHDISRLKSSEVPFLRRQIGMIFQDHHLLMDRTVYDNVAMPLIISGASSEDIRRRVSA
ALDKVGLLDKARNLPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDGELSEGILRLF
EEFNRVGVTVLMATHDVGLIARRNYRTLTLSQGRMSGGVY
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattcgctttgaacaggtcagtaaagcttatctgggcggacgacaggcgcttcagggc
gtcaactttcacatccagcaagcagaaatggcatttctgaccggacactctggcgcgggt
aaaagtaccctgctgaagctgatttgcggcattgagcgcccgagtgccggacacattttg
tttggcggtcatgatatcagccgcctgaaatccagtgaagtgccgttcctgcgtcgacag
atcggcatgatctttcaggatcaccatctgctgatggatcgtaccgtctatgacaacgtg
gcaatgccgctgatcatatccggtgccagcagtgaagatattcgccgccgcgtgtcggct
gcgctggataaagtgggattactggataaagccaggaacctgccgatccagctttccggc
ggtgaacaacagcgtgtgggtattgcccgcgcagtggtgaacaagcctgcggtgctgctg
gcggatgaaccgaccggtaaccttgacggcgaattgtcggaagggattttgcgtttattc
gaagaatttaaccgtgtcggcgtcaccgttctgatggcgacgcatgacgtgggtctgatt
gcccgtcgtaattaccgcacgctgacgctgagtcaggggcgtatgtcgggaggggtgtac
taa

DBGET integrated database retrieval system