KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4318Help
Entry
Rahaq2_4318       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcrB DUF1454
Motif
Other DBs
NCBI-ProteinID: AEX54071
UniProt: H2IWM2
Position
4596395..4596961
Genome map
AA seq 188 aa AA seqDB search
MRNIAKMMGMAVLIAGLAACDGKSTDAPAADKGAPAAAATATTAPVSLLDGKVTFSLPQG
MSDQSGKLGTQANNMHVYADSTGQKAVIVILGDNTPESLDVLAGRLQDQQKARDTNLQVV
TNKSIQVNGQTLQQYDSVITSAGQKAYSSIVLAKVDSHLLTLQITLPADNQQQAQTDAEA
IISTLKIQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatatcgcgaaaatgatgggaatggcagtgctgatcgccggtctggctgcgtgt
gacggtaagtcgaccgatgcaccagccgcagataaaggcgcgccagcggccgcagcgacg
gcaaccaccgcgccggtcagcctgctggacggtaaggtcaccttctccctgccgcaggga
atgagcgaccagagcggtaaactgggtactcaggcaaataatatgcacgtgtatgccgac
agcaccggccagaaagcggtgattgtcattttgggcgataacaccccggaatcactggac
gttctggcaggtcgtttacaggatcagcaaaaagcgcgcgatactaatctgcaagtcgtc
accaataaatctattcaggtaaacggccagacattgcagcagtacgacagcgtgatcact
tctgccggtcagaaagcctattcgtctatcgttttggccaaggtcgacagccatctgctg
accctgcaaattactctacctgctgataatcagcagcaggcgcagactgatgcagaagcc
attatcagcacactgaaaattcaataa

DBGET integrated database retrieval system