KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4331Help
Entry
Rahaq2_4331       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T3SS_needle_reg
Motif
Other DBs
NCBI-ProteinID: AEX54084
UniProt: H2IWN5
Position
4611519..4612787
Genome map
AA seq 422 aa AA seqDB search
MSLAKIILLVFISTFSISSFAIPVNTAHLDSLYEQRMLPNGKSVGIIHIYSEYPKYGWVK
DPIEGVSAIDDISRALVFYTGLYSHQPAPAVMNKIIHLTRSILMMQAENGYFYNFIYPDN
SINTTYKTSVAEPNWWTWRALWALASAYPVVKAQDETLAAQMHNVLFRQTQALTGYVQET
QTLTTLKGITLPVWMPNGGADQAAILLLALTRMQQISPQPNIEKMMRMLASGIMTMQIRD
VTSSANGVFLSWKNTWHGYGNNQAYALLEAGTVLNDRDMVKAAFYELDNFHPWLISQGYL
TSFSVSKTGESVEMNDKQQFSQIAYIFRPMIFANLRAYEISRDTRYIDQAVTLAMWFYRG
NVARIQMYLPDSGLAFDGLDPEKSVNRNSGAESTIETLLALDAIERSPLAKKQLEERLSR
GK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgcaaaaataatattactggtttttatttcaacattctctatctcttctttt
gctatacccgtcaatactgcgcatctggattcactttacgaacaaaggatgctcccgaat
ggcaaatcggtaggaattattcatatttatagtgaatatcctaaatatggatgggtaaaa
gatccgattgaaggtgtttctgctatcgatgatatttcacgtgcgctggtgttctatacc
ggtttgtattcgcatcagcccgctcctgcggtgatgaataaaatcatccatctgacccgc
agcattttgatgatgcaggctgaaaacggttatttctataatttcatttatccggataac
tccatcaataccacttataaaaccagcgtcgctgaaccgaactggtggacgtggcgggct
ttatgggcactggccagcgcgtatcctgtcgtgaaggcgcaggatgaaacactcgccgca
cagatgcacaatgtccttttccgccagactcaggccctgacaggttatgtacaggaaacg
cagaccctgacgacattaaaagggattacgttgcccgtatggatgccgaatggtggtgca
gatcaggccgccattctgctgctggccctgacccgtatgcagcaaatttcgccccagcca
aacatcgaaaaaatgatgagaatgctggccagcggcatcatgaccatgcaaatacgcgac
gtcacatcgtccgcaaatggcgtgttccttagctggaaaaatacctggcatggctacggc
aacaatcaggcttatgcgttgcttgaagccggaacagtattaaatgacagagatatggtg
aaagccgcgttttacgagctggataattttcatccgtggttaatcagtcagggttatctc
accagtttctccgtcagcaagaccggggaaagtgttgaaatgaatgataaacagcaattt
tctcaaatcgcttatatcttccgtccgatgatttttgccaatttacgtgcttatgaaatt
tcgcgagatacccgctatatcgaccaggccgtgacgctggcgatgtggttctacaggggg
aacgtagcgcggatccagatgtacttaccggattccgggctggcatttgacgggctggat
cccgaaaaaagcgttaaccgtaactcaggcgcagaatcgacaatagaaacgctgctggcg
ctggatgcgattgaacgctcgccgctggcgaagaagcaactggaggaaaggttaagtcgc
ggaaaatag

DBGET integrated database retrieval system