KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4333Help
Entry
Rahaq2_4333       CDS       T01770                                 

Definition
(GenBank) filamentous hemagglutinin family N-terminal domain protein
  KO
K15125  filamentous hemagglutinin
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:raq00536]
    Rahaq2_4333
Glycosaminoglycan binding proteins [BR:raq00536]
 Heparan sulfate/Haparin
  Microbial pathogens
   Rahaq2_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haemagg_act Fil_haemagg Bactofilin OstA
Motif
Other DBs
NCBI-ProteinID: AEX54086
UniProt: H2IWN7
Position
4614728..4616053
Genome map
AA seq 441 aa AA seqDB search
MDNHQQPTCFAQSLLSYLICGLLAGQPVFPAFAAPTPANGATGIDKAGNGVPVVNIATPN
GAGISHNQFQNYNVGKEGLILNNATGQLNQTQLGGLIQNNTNLKAGHEARGIINEVTGTN
RSQLNGYTEVAGKAANVMVANPYGITCNGCGFINTPNATLTTGKPVFDASGNLHSLDVKK
GSITIEGQGLNARESDALSIIARATEVNAQIHANAMNVIAGANRVDKNGRITAIAGEGAA
PVVAVDTGALGGMYASRIRLVSSDKGVGVNLGNLNARQGDITLDANGKLTVQNSLASGSL
NAKGESVTLSGEHKASGSMNVSGQDIALSNGTFASDNNIALNSEGKLTLSNSRLTAGNSL
SLNAQDLTQDGRSSVNTARDISAQVAGTITNQGQLIAGNNAAISSGTLSNSGKIAAKGTT
SISAVKALSNAAGRIRPRAAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggataatcatcaacaaccaacctgctttgctcaaagcctgctgagttatttgatctgt
ggcttgctggcaggacaaccggttttcccggcgtttgccgcaccgacccctgcaaatggg
gccaccggtatcgataaggccggaaacggtgtgccggtggtgaatattgccacgcccaac
ggcgcgggaatttcccataaccagtttcaaaattacaacgtcggcaaagaggggctgatc
ctcaacaatgctaccggtcagctaaaccagacgcagttaggcgggctgattcagaacaac
acgaatctgaaagcaggccatgaagcgcgcggcatcattaatgaagtgacgggcacgaac
cgctcacaactgaacggctataccgaagtggccggaaaagcggcaaacgtgatggtggcg
aacccgtatggcatcacctgtaacggctgcgggtttatcaatacaccgaatgctacgctc
accacgggtaaaccggtgttcgatgcgagtggcaacttacactcccttgatgtcaaaaaa
ggctccatcaccattgaaggccaggggctgaatgcccgcgagtcggatgcgttgtcgata
atcgcgcgcgccacagaagtgaatgcacaaattcatgctaacgcgatgaacgttatcgcc
ggtgctaaccgcgtggataaaaatggccgcatcaccgcgattgccggtgaaggcgcagca
cccgtggtggcggtggataccggcgcactcggtggcatgtacgccagtcgtatccgtctg
gtttccagtgacaaaggcgtgggcgttaaccttggcaacctgaacgcacgccagggagat
atcacgctggatgccaacggcaaactcaccgtgcaaaacagccttgccagcggcagcctg
aatgccaaaggggaaagcgttacgctgagcggtgaacataaagccagtggcagtatgaat
gtcagcgggcaggacattgcacttagcaatggcacctttgccagcgacaacaacatcgcc
ctgaacagcgagggcaaactgacgttaagcaacagccgtttgaccgccggaaacagcctc
agtctcaacgcacaagatttaacccaggatggccgcagcagcgtcaatacggcgcgtgat
atttcagcgcaggtggcgggaacgataaccaatcagggccagctgatagccggtaacaac
gccgctataagcagcggtaccctttccaatagcggaaaaattgctgccaaaggcactacc
tcaataagtgccgtaaaagcactgagcaacgcagcgggcagaatacggccacgggcagca
cgctga

DBGET integrated database retrieval system