KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4335Help
Entry
Rahaq2_4335       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX54088
UniProt: H2IWN9
Position
4618245..4618511
Genome map
AA seq 88 aa AA seqDB search
MMAKFILKYSLFFLYSYFFCIASLLLIGLAISGVYYFSNGIFNFSVSQVKRALFFGFIGG
SGISLGTVLFNTIDWYNARKKPPTDPNE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgatggctaaattcatcttgaaatatagtttattctttttatacagctattttttttgc
atagcctcactgttgctgattgggttggctatctcaggcgtatattatttttcaaatgga
atatttaacttctcggtttcgcaagtaaagagagcattatttttcggatttattggtggc
tcaggaatttcattaggcacggtactattcaatacaatcgattggtacaacgcccgtaaa
aagcccccaaccgatcctaatgaatga

DBGET integrated database retrieval system