KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4337Help
Entry
Rahaq2_4337       CDS       T01770                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIB
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEX54089
UniProt: H2IWP0
Position
complement(4618815..4619624)
Genome map
AA seq 269 aa AA seqDB search
MYHVVASDLDGTLLSPDHTLTPFAKETLKLLTQRGVHFVFATGRHHIDVAQMRDNLEISA
YMITSNGARVHNTDGDLIFSHNLDEDIARDLFGIMHNNPDILTNVYRNDDWYMNRDRADQ
DDFFRESVFKYKLYEPGLLETDGICKVYFTCEDHEKLLPLEEAINARWGDRVNVSFSLPV
CLEVMAGGVSKGHALEYVSKLMGYSLKDCIAFGDGLNDLEMLTMAGKGCLMSGSLPRLKA
AMPDAEIIGSNADDAVPHYLRKMYLSEER
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatgttgttgcttccgatttagatggcacgctgctatcacctgatcataccctg
accccgttcgccaaagagacgctgaaactgctgacgcagcgcggcgtgcatttcgtgttc
gccaccgggcgtcaccatatcgacgtggcgcagatgcgcgacaatctggaaatcagtgcg
tacatgatcacttccaacggtgcgcgtgtgcataacaccgacggggatctgattttctcg
cataatctggatgaagacatcgccagagacctgttcggcattatgcataacaatcctgat
attctgaccaacgtttatcgcaacgatgactggtacatgaaccgtgaccgtgccgatcag
gatgattttttccgcgaatccgtttttaaatacaaactgtatgaaccgggtctgctggaa
actgacggcatctgcaaagtgtatttcacctgtgaagatcacgaaaaactgctgccgctt
gaagaagccatcaatgcgcgatggggcgaccgtgtgaacgtcagtttctcactgccggtg
tgtctggaagtgatggcaggcggcgtatcaaaaggccatgcgctggaatatgtctccaaa
ctgatgggctattcgctgaaagattgcatcgcttttggtgatggtctgaatgacctggaa
atgctgacgatggccggtaaaggttgtctgatgagcggttcattaccacgtctgaaagcc
gccatgccggatgccgaaatcatcggctccaatgctgacgatgccgtgccgcattacctg
cgtaaaatgtatttgtctgaagaacgctga

DBGET integrated database retrieval system