KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4343Help
Entry
Rahaq2_4343       CDS       T01770                                 

Definition
(GenBank) uncharacterized protein, possibly involved in aromatic compounds catabolism
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3 DUF4442
Motif
Other DBs
NCBI-ProteinID: AEX54095
UniProt: H2IWP6
Position
4625223..4625705
Genome map
AA seq 160 aa AA seqDB search
MSASSLSHEAALQLIGNIFVYDMPFNRELGLELKRLDCDYAELKFTNQTRLVGNAAQKIL
HGGVIAAVLDVAAGLVCVTSSLIRRDKPDHPLLEAEMRQRLSRMGTIDLRVDYLRPGRGE
YFIASASLIRAGNKVSVARVDLHNDTGIHIATTTATYMVG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttcatctctcagccacgaggctgccctgcaactgatcggcaatatcttcgtt
tatgatatgccgtttaaccgtgaactgggcctcgagctgaaacgcctcgactgcgattat
gctgagctcaaattcaccaatcagacccggctggtgggtaacgcggcgcaaaaaatttta
cacggcggcgtgattgctgcggtgctggatgtcgccgccggtctggtttgtgtgaccagt
tcactgatccgccgtgacaaacctgatcacccgctgctggaagccgaaatgcgtcagcgt
ttatccagaatgggcaccatcgatttacgcgttgattacctgcgtccgggccgtggcgag
tattttattgcctcggccagcctgatccgtgccgggaataaagtctccgtggcgcgcgtg
gatttgcacaacgacacgggaattcacattgcgaccaccacggcgacgtatatggtgggc
tga

DBGET integrated database retrieval system