KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4344Help
Entry
Rahaq2_4344       CDS       T01770                                 

Definition
(GenBank) rarD protein
  KO
K05786  chloramphenicol-sensitive protein RarD
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Transporters [BR:raq02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Rahaq2_4344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: AEX54096
UniProt: H2IWP7
Position
4625754..4626659
Genome map
AA seq 301 aa AA seqDB search
MDAQRTRQGVIFAFIAYLIWGIAPAYFKLIKQVPADEILTHRVIWSFFFMLVLLSVSRSW
GDVCQVFTQPKKVGMLLITALLVGGNWLIFIWAINHNHILEASLGYFINPLVNVVLGMLF
LRERFRSLQWFAVALAFAGVLVQVWVFGSVPVIAIGLSLTFAFYGLLRKKIGVDSQTGML
IETLWLLPVAGIYLFFIARSPTSNLAANPWSLDLLLMAAGIITTIPLLFFTAAAARLKLS
TLGFFQYLGPTLMFLLAVVFYGETVNASQLITFGFIWVGLLCFISDALYTQGRLRRGRRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacgcacaacgtacccggcaaggtgttatttttgcctttatcgcctatctgatctgg
gggatcgcgccggcgtatttcaaactcatcaaacaggtgccggcggatgaaattctcact
caccgggtgatctggtcattcttcttcatgttagtactgctgtccgtcagccgcagctgg
ggagatgtctgtcaggtattcacacaacctaagaaagtcggcatgttactgattaccgcc
ctgcttgtcggtgggaactggctgattttcatctgggcgattaatcataatcacattctg
gaagcgagccttggctactttatcaatccgctggtaaatgtggtgctcggcatgctgttt
ttgcgtgaaagattccgaagtttgcaatggtttgccgtggcgctggctttcgccggggta
ctggtacaggtctgggtatttggttccgtgccggtcatcgccatcgggctgtccctgacg
ttcgccttttacggcctgctgcgtaaaaaaattggcgtggattcgcaaaccgggatgctg
attgaaaccctctggctgctgccggtcgccgggatttatctgttctttattgcccgcagc
ccgaccagcaatctggccgcgaatccgtggtctctggatctgctgctgatggcggccggg
attattaccaccattccgctactgttctttaccgccgctgctgcccggctgaagctgtcc
acgctgggctttttccagtatctcggcccaacgctgatgttcctgctggccgtggtgttt
tacggtgaaaccgtcaacgcctcacaacttatcaccttcggctttatctgggtgggtttg
ctgtgctttatcagcgatgcgctctatacacaggggcgtttaagacgaggaagacgcgct
gcgtga

DBGET integrated database retrieval system