KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4347Help
Entry
Rahaq2_4347       CDS       T01770                                 

Definition
(GenBank) WxcM-like protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 FdtA DUF1971
Motif
Other DBs
NCBI-ProteinID: AEX54099
UniProt: H2IWQ0
Position
4629069..4629545
Genome map
AA seq 158 aa AA seqDB search
MIKQINQDTLCDLITQAAHSPRLRQNLNMHPAPEDDVQRLAIAMEPGTYVRIHRHPHTWE
MLTALRGRFLVLIYDNSGKVTDRLWLGAETLLLEIPANTWHSVLSLDEGGVIFEVKHGAY
QPVQEQDYLPGTPPEGEEGVKETLEWYAKAEVGETFSL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcagattaaccaagatacgttatgcgacctgatcacccaggcggcgcattcg
ccgcgactgcgccagaatctgaatatgcatccggcaccggaggacgacgtacagcgtctg
gctatcgccatggaacccggcacttatgtgcgcattcaccgccatccgcacacctgggaa
atgctgaccgcgctgcgtggccgctttctggtactgatttacgataacagcggtaaagtc
accgaccgtctgtggctcggcgcagaaacccttctgctggaaatcccggccaatacctgg
cacagcgtattatccctcgacgaaggtggcgtgatttttgaagtgaaacacggtgcttat
cagccggtgcaggaacaggattatttgccaggcaccccgccggaaggcgaagaaggcgta
aaagaaacgctggaatggtatgcgaaagccgaagtgggtgaaacttttagcctctga

DBGET integrated database retrieval system