KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4349Help
Entry
Rahaq2_4349       CDS       T01770                                 

Definition
(GenBank) haloacid dehalogenase superfamily enzyme, subfamily IA
  KO
K20862  FMN hydrolase / 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.102 3.1.3.104]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00740  Riboflavin metabolism
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
Module
raq_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rahaq2_4349
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     Rahaq2_4349
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     Rahaq2_4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: AEX54101
UniProt: H2IWQ2
Position
complement(4631948..4632664)
Genome map
AA seq 238 aa AA seqDB search
MKFYRPLKRIEAITFDLDDTLYDNYDVIRRTDTETLKFMQGFHPALADMAPDAVRLMRTE
LLAQDAEIYHDVTEWRRQAVLLAMTRAGLSRSEAEQGTKATMETFAKWRSRIYVPQENHD
ALAALAERWPLVAITNGNADPHACGLAQYFQFTLRAGDHGRAKPYADMYKKTSMKLDIPL
ENILHVGDDLTTDVAGSVRCGMQSCWINLREGNLIHIKDARLLPHIEISQLASLTALL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctatcgtccgctgaaacgcattgaagcgatcaccttcgatttagacgacacg
ctgtatgacaattacgacgttatccgccgtaccgataccgaaacactgaaattcatgcag
ggtttccacccggcactggcggatatggcaccggatgctgtccgcctgatgcgcacagaa
ttactggcgcaggatgcggagatttatcacgatgtcaccgaatggcgccgtcaggcagtt
ttactggcaatgacccgtgccggcctgagtcgcagtgaggctgaacagggcaccaaagcc
accatggaaaccttcgcgaagtggcgcagccggatttatgttccgcaggaaaaccacgac
gcgctggcggcgctggctgagcgctggccgctggtcgctatcaccaacggcaatgccgat
ccgcacgcctgtggtctggcacaatacttccagtttacattgcgcgcgggcgatcatggc
cgtgcaaaaccgtacgccgacatgtataaaaaaacgtcgatgaagctggatattccgctg
gaaaacattcttcacgtcggtgatgacctgacgacagacgtcgcgggctcagtgcgttgc
ggtatgcaatcgtgctggattaatttgcgtgaaggcaacctgatacacattaaggatgcc
cgtctgttgccgcatattgagatttcgcagttggcatcgctgacagcattgctataa

DBGET integrated database retrieval system