KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4351Help
Entry
Rahaq2_4351       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K09921  uncharacterized protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rahaq2_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF484 Spc29
Motif
Other DBs
NCBI-ProteinID: AEX54103
UniProt: H2IWQ4
Position
complement(4633572..4634276)
Genome map
AA seq 234 aa AA seqDB search
MNNLDDQIEPVTALDDDSVMQYLLQNPDFFIRNARSVEQMHVPHPVKGSISLVEWQLGRQ
RHQIAQLEEEITLLMEQASVNEALFGRMIELQATLAAASSLQDMLNRLQRWARSLGLAGA
NVRLFSEGWRIGAPSDFTHLALSRSAFESMRIQRLGETPHYLGGLNGPELLLLLPQAKAV
GSVALSLMGEQGELGVLIFSSRDPQHYQPGMGTVLLNQLAKMLPGLLERWIERV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcttgatgaccagattgaaccggtgacagcgctcgacgacgacagcgtgatg
caatacctgctgcaaaacccggatttctttattcgcaatgcgcgcagcgtcgaacaaatg
cacgtaccgcatccggtgaaaggcagtatttcgctggttgaatggcaactcggacgtcag
cgtcatcagattgctcagcttgaagaagagattacgttgctgatggagcaggcttcggtc
aacgaagcattgttcgggcggatgatcgaactccaggccacgcttgcggcggccagcagt
ctgcaggatatgcttaaccgtctgcaacgctgggcgcgcagtctggggctggcaggtgcc
aatgtgcgcttgttcagtgaaggctggcgcatcggcgcgccatcagatttcacccatctc
gcgttaagccgcagcgcatttgaatccatgcgcatccagcgtctgggtgaaacgccgcat
tatctcggcggcctgaacggcccggaattactgctgttattaccgcaggcgaaagcggtg
gggtccgtcgcactgtcgctgatgggcgaacagggtgagctgggcgtgctgattttcagc
agccgtgatcctcagcattatcagcccggcatgggcacggtgttactcaaccagctggca
aaaatgttacctggcctgctggaacgctggatcgaacgggtatga

DBGET integrated database retrieval system