KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4352Help
Entry
Rahaq2_4352       CDS       T01770                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00300  Lysine biosynthesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01120  Microbial metabolism in diverse environments
raq01130  Biosynthesis of antibiotics
raq01230  Biosynthesis of amino acids
Module
raq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq2_4352
Enzymes [BR:raq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Rahaq2_4352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF
Motif
Other DBs
NCBI-ProteinID: AEX54104
UniProt: H2IWQ5
Position
complement(4634273..4635097)
Genome map
AA seq 274 aa AA seqDB search
MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHRGVGFDQLLVVEPPYDPELDFHY
RIFNADGSEVAQCGNGARCFARFVRIKGLTNKRDIRVSTQTGRMVLTVTEDEEVQVNMGE
PVFEPQQVPFRAAKPEKTYILRAEERTVFCGVVSMGNPHCVLQVDDVLTAEVEVLGPMLE
SHERFPERVNVGFMQILSPESVKLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVQV
ELPGGSLDIRWKGPGYPLYMTGPATHVYDGFIHL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctccaaaatgcacggcctgggtaacgactttatggtcgttgatgccgtcact
caaaatgtctatttttctcctgagttgatccgtcgtttgtctgaccgtcaccgtggtgta
ggttttgaccagttactggtggtggaaccgccttacgatcccgaattagacttccattac
cgcatttttaacgcggatggcagcgaagtggcacagtgtggcaatggtgcgcgctgtttt
gcccgctttgttcgtatcaaaggtctgaccaacaaacgcgatattcgcgtcagtacacaa
accggtcgcatggtgctgactgtcaccgaagatgaagaggtgcaggtcaacatgggcgag
ccggttttcgagccgcagcaggtgcctttccgtgcagcgaaaccggaaaagacctatatt
ctgcgtgctgaagagcgcacagtattttgcggtgtggtgtcgatgggaaacccgcactgc
gtattacaggttgatgatgtgctgacagcggaagtcgaggttctcgggccgatgctggaa
agccacgagcgtttccccgagcgcgtgaacgttggtttcatgcagatcctcagcccggaa
agcgtaaaattgcgcgtgtacgagcggggtgccggtgaaacacaggcgtgcggaagcggt
gcctgtgccgctgtggcggtcggcattcagcaaggtttactcgcagaagaagttcaggtg
gaactgccgggaggcagcctcgacattcgctggaaagggccgggttatccgttatatatg
accggacctgccactcatgtttacgacggatttattcatctatga

DBGET integrated database retrieval system