KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4596
Entry
Rahaq2_4596       CDS       T01770                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4596
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4596
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEX54324
UniProt: H2J177
Position
pRahaq201:35265..35696
AA seq 143 aa
MNSKSPSLYEILTGNFAGGLDLHNVSEENQVILSVLDNMQRILNCRAGTLSHLPDYGLPD
MSKILQGMPGTAHSLLDVLSETLLKYEPRIKKLHVILLPQSSPGHLEYAIDAELKELGLV
RFGTEFMPEGRVLMRHMKQQNYV
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaactcaaaatccccttctctgtatgaaatcctcactggcaattttgccggcggcctc
gatctgcacaacgtcagcgaagagaatcaggtgatcctctccgtgctcgacaacatgcag
cgtattctcaactgtcgtgccggcacgctcagccatctgccggattacggcctgccggac
atgagcaaaatcctgcaggggatgcccggtacggcacattcactgctggatgtcttgtca
gaaaccctgctgaaatacgagccgcgcatcaaaaagttgcacgttattttattgccccag
tccagccccggacatcttgaatatgccattgacgccgagctgaaagagcttggcttagtg
cgattcggtaccgaatttatgccggaaggccgcgtactgatgcgccatatgaaacagcag
aattacgtgtga

DBGET integrated database retrieval system