KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4598
Entry
Rahaq2_4598       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4598
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4598
SSDB
Motif
Pfam: VasL ImpA_N Peptidase_M29
Other DBs
NCBI-ProteinID: AEX54326
UniProt: H2J179
Position
pRahaq201:36749..38146
AA seq 465 aa
MMAQDINRQLRTGGDPRALADYAVLREELSKLTHPARPDVDWKKVEQLCLNLFQQNGIEL
QTASWYTQARTRLTGMSGLNEGLAILEALISRQWPGLWPQPVHARMEILSGLSQRLQQTL
RSMTLDYHDLSQIYQAEKLINALCEVLQRLELKHVSQLEALSSFMHGAAVRLENMHAASD
TTIVLPAAATENTEKRWATQAREQWVYVAQAEPAEPQVTITPPAPVKHPVQWKGFIAGIM
ATLLAGGGVCAAITAFYHPPSGEQLMATLPVMPKPLNAQTLETLKNRQAEMLHREAPAYL
AAMQQQTRQLATLSPRWAQDTGSHLVSQALILWPDNPATAALAKSWTQQLNANAVPLENL
SGWQQANTQLQQLADKLNGLDEQRGKYMTVSQLKSSVFAIQQALNGSPPVEESLRKLAQD
KQQNKDVSPQLMMQLDNQFTQLLNRYVLLTQTLPATAGKNGQADN
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatggcccaagacataaaccgccagctacgcaccgggggtgacccgcgtgcgctggct
gattacgccgttttacgcgaagaactgagcaaattaacccatccggcgcgtccggatgtg
gactggaaaaaggtggaacaactgtgtctgaacctgtttcagcagaacggtatcgaactg
caaacggcgtcgtggtacacacaggccagaacgcggttaacgggtatgtcaggattaaat
gaagggctggcgatcctcgaggcattgatttcacggcagtggccgggactgtggccgcag
ccggtgcatgcgcggatggaaatactctccggcctgagccagcgtctgcaacagacattg
cgcagcatgaccctggattatcacgatctgtcgcagatctatcaggccgaaaaactgatc
aatgcgctgtgcgaggtcttgcagcgtctggagctgaagcatgtcagccaactggaagca
ctgagcagttttatgcacggtgctgccgtgaggctggaaaatatgcacgcggccagcgat
acgacaatcgtattacctgcggcggcaacagagaacacggaaaaaagatgggctacgcaa
gcccgcgagcagtgggtgtatgttgcacaggctgagcctgccgaaccacaggtgacgatt
acgccacccgcgccggtgaagcatccggtgcaatggaaagggtttatcgccggaatcatg
gcaacgttgctggctggcggcggagtctgcgcagctatcacggcgttttatcatccgccc
tccggtgaacaactgatggcgacgctgccggtaatgccaaaaccgctgaatgcccagaca
ctggaaacgctgaagaaccggcaggctgagatgctgcaccgtgaggcaccggcgtatctg
gccgccatgcagcagcaaacgcgccagctcgccaccttgtcgccgcgctgggcgcaggat
accgggtcacatctggtcagtcaggcactgatactgtggcctgataatccggcgaccgct
gcgctggcgaaaagctggacgcagcaactgaacgccaatgccgtgcctttggaaaacctc
agcggctggcaacaggccaatactcagctgcaacaactggcggacaaactcaacgggctg
gatgagcagcgcggtaaatatatgactgtctcgcagctaaaatcctccgtttttgccatc
cagcaggcgctcaacggttcaccgccggtagaagaatcgctgcgtaaactggcgcaggac
aaacagcaaaataaggatgtttcaccgcagttgatgatgcaactggataatcagttcacg
cagctgctgaaccggtatgtgttgcttactcaaaccttaccggcgaccgccggtaaaaat
ggtcaggcagataactga

DBGET integrated database retrieval system