KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4769Help
Entry
Rahaq2_4769       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq2_4769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4769
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AEX54492
UniProt: H2J1P5
Position
pRahaq201:complement(208784..212152)
Genome map
AA seq 1122 aa AA seqDB search
MTKSLHLMLVVMLALALSVLWLSVDGETLTHGVAWWATGVILLSYFLLARYAFALELLDF
NRPPETQDDARITAFDTLRFTLRHRYDWHWKHKQPWLLVTGEAAVVEKIAPGLTQARWQE
SQNAVLIWCGEADALDLAAVTQLRDMRGRRAFNAVLWVTDVTAEPQYLWTTQPVPNQTLP
AGNSDTVYRQFIALGHTLSWRPPVFGVCLSEPQWEQDDRPVQSIGCHWPAGTPVSLDDQL
SQLAATLIPQGIAQLNENKHWAWLLQLSGDLKHHTGALLRQRFQPWLGENQRVLAGGIFF
MPAAPESASVQQRSHACYLSPAWNGVIAQSRMQQGRRDHLSTGDRLAIGTLTLAGLWVLG
MGISACANRALIADSQALLQAARTPAPMSDTLTRSVALQDNIDRLLWWQQNGSPWLHRFG
LDQRDAVIEALWPAYTRQSQALLITPMVNALKDRLQAFVSLPPGSAERRLAGKLAYQQLK
AYLMLMHPEHADPAFMQPVLSPLWTVPDGVAPGEWLARSDKLLAFYLQQLPRHPQWKLPA
DDTLVANVRTILRSQKGISNSENALYQQVLLSVSPHYADVTLDSLLGEFAGGQLFSTDDT
LPGMFTREAWEGEVSDAIDKAAAARHVTSDWVLDDKGEQQLLTKDPLQYRLTERYFADYT
SAWLNFLNSIRWNTSDSLSTSLDQLTRLADARQSPLLALSRTLRYQGAAGQHREAMGDSL
LKSAQKLVSKTTPDAGFAGGRNDPTRVLSETFAPLLAVLPPETPAAGETQTVQNTAVVSV
SNYLLQVSQTRLQLMQVANASDPQAMAQNLVRSAFSNGDTTLSQGRHYAQLLAASLGGEW
SSFADAAFVQPLEQAWNGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQ
LAHYLTPDTGLIDQFITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRR
VFPQGKPGVTFELQIRPTRNVVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLT
YSPVAASGKSADAFQSYFQADGGWAWLRLLDKAQVEQLDSSRYRLSWQTATRETLNVVLR
TQSGGGPLELLTLRRFTLPAQIFTSPGLATDNAEDTTHHDAR
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaagccttcacctgatgctggtggtgatgctcgccctggccctgagcgtcctg
tggctgagcgtggacggggaaaccctcacccacggcgtagcctggtgggcaaccggcgtc
atcctgctgagctattttctgctggcccgctacgccttcgccctggaattgctcgatttt
aaccgcccgcccgagacacaggacgatgcgcgcatcacggcgtttgataccctgcgtttc
accctgcgtcaccgctatgactggcactggaaacacaaacagccgtggcttttggtcacc
ggtgaggcagcggtggtggaaaaaatcgcccccggcctgacgcaggcgcgctggcaggaa
agccagaacgccgtcctaatctggtgtggcgaggccgatgcgctggatttagccgccgtg
acgcagctgcgcgacatgcgcgggcgccgcgcctttaacgccgtgctgtgggtcactgat
gtgacggctgagccgcaatacctgtggactacgcagccggtgcctaatcagacgctgccg
gcgggcaacagcgacaccgtatatcggcagtttatcgcgctcgggcacaccctcagctgg
cgtccgccggtgtttggcgtgtgcctgagtgagccgcagtgggaacaggacgaccgcccg
gtgcagagtatcggctgtcactggccggcgggcacgccggtctcacttgatgaccagctc
agtcagttggccgccacgctcattccacagggcattgcgcagctgaacgagaacaaacac
tgggcctggctgctgcagctgtctggggatttgaaacaccacaccggcgcgttgctcagg
cagcgttttcagccgtggctcggtgagaatcagcgcgtgctggccggcggcatcttcttt
atgcctgctgcccctgaatcagcttctgttcagcaacgctcccacgcctgctatttgtcc
cccgcctggaacggcgttatcgcgcaaagccggatgcaacagggccgccgcgaccacctg
tccaccggtgacagactggccatcggcacgctgacgctggcggggctgtgggtactcggc
atgggaatatctgcctgtgccaaccgcgcgcttatcgccgacagccaggcgctgctgcag
gcggcccgcacgccggccccgatgtccgacacgctgacccgcagcgtcgccctgcaggac
aacattgaccgcctgctgtggtggcagcaaaacggctcgccgtggctgcaccgcttcggt
cttgatcagcgcgatgcggtgatcgaagcactgtggcccgcctatacccggcaaagtcag
gctctgctgataacgcctatggttaacgcgctgaaagaccggctgcaggcgtttgtgtcc
ctgccgccgggctctgccgaacgacgtctggccgggaaactggcctatcagcagctgaaa
gcttacctgatgctgatgcatcctgaacacgccgatccggcctttatgcagccggtgctg
tctcctctgtggacggtgccggacggcgtggctcccggagaatggctggcccgttcagac
aaactgctcgccttttatctgcagcaactgccgcgccatccgcagtggaagctgcctgcc
gatgacactctggtggccaacgtgcgcactattctgcgcagccagaaaggcatcagcaac
agcgaaaacgcgctgtatcagcaggtgttgctgagcgtgtcgccgcactatgccgacgtc
acgctcgacagcctgcttggagagtttgccggcggtcagctgttctccaccgatgacacc
ctgccgggcatgttcacccgtgaagcctgggagggggaagtcagcgacgcgattgataaa
gcggcggcggcacgccacgtcacctccgactgggtgctggatgataaaggcgaacaacag
ctgctgaccaaagacccgctgcagtaccgcctgaccgaacgctactttgccgattacacc
agcgcctggctcaatttcctcaacagcatccgctggaacaccagcgactcgctgagcacc
tccctcgatcagctgacccggctggccgatgcccgtcagtcgccgctgctggccctgagc
cgcaccctgcgttatcagggcgcggccggtcagcaccgcgaagcgatgggggattccctg
ctgaaatcggcacaaaagctggtgtcgaaaaccacgccggacgccggatttgccggcggg
cgcaatgacccgacccgcgtactgagcgagaccttcgccccgctgctggccgtgttaccg
ccggaaaccccggcggcaggtgaaacgcaaaccgtgcaaaacaccgccgtcgtttccgtc
agcaactatttgctgcaggtgtcacaaacgcggctgcaactgatgcaggtggccaatgcc
tccgacccgcaggcgatggcacaaaacctggtcagatccgccttcagcaacggtgacacc
acgctgtcgcaggggcgtcactacgcacagcttctggcggccagccttggcggagagtgg
agcagctttgccgacgccgcgtttgtccagccgctggaacaggcgtggaacggcgtgatg
actccggcacagcaggggatcaacagcgcctggcaggttcaggtgcagaacccgtggcag
gcggaatttaccggacgctacccgttcgataacaccaaaaatgacgcggatttcacccag
ctggctcactatctgacgccggataccggcctgattgaccagtttattacccggcaactg
gccggcgtgctggaaaagcagggtgacagctgggtacctgacccgctcaacacccaggga
atgagcatcaacccggacttcctcagcgcggttaaccagctgagccagcttggccgccgc
gtcttcccgcagggcaaacccggcgtgacctttgagctgcagatccgcccgacccgcaac
gtggtagaaactgacctgcagatagacgacgccaccctgaagtactttaaccagctgccg
ggctggcagacgttccgctggccagacgccgccagcgatcatccacaggtgtccctgacg
tactcaccggtcgcggcatcagggaaaagcgccgacgccttccagagctattttcaggcg
gacggaggctgggcctggctgcgtttactcgataaggcgcaggttgaacagctcgacagc
agccgctatcgcctgagctggcaaaccgccaccagagagacgctgaacgtggtgttacgc
acccaaagcggcggtggcccgctggaactgctgaccctgcgacgctttacgttgccggcc
caaatatttacctctccgggcctggccacggacaatgcggaggacacaacgcaccatgac
gcccgataa

DBGET integrated database retrieval system