KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4863
Entry
Rahaq2_4863       CDS       T01770                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4863
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4863
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEX54580
UniProt: H2J1Y3
Position
pRahaq201:316147..316626
AA seq 159 aa
MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFSKDDMPLRDRRFTHIDK
DNFNNVMEGMKPAVEMLVESTLPEKEGQMAIALEFNSMDDFSPENVAMQVEPLRKLLELR
EQLSDLRNRTASNDRLKEQLVELLEGMTKNAEPAKGDAE
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgagcaatacacaatataagttgagcaaggcgcgtccccctcgcgttcaaattacgtac
gacgttgaagttggcggtgctgaatccaaaaaggaattaccgctggtgatgggagttatc
gggaatttttccaaagatgacatgccgttacgtgaccgccgttttacgcacattgataaa
gacaacttcaataatgttatggaaggaatgaaaccggctgtagaaatgttggttgaaagt
accttgccagaaaaagaaggccagatggctattgctctggaattcaattctatggatgac
ttctctcctgaaaacgtggcgatgcaagtggaaccgttgcgcaaacttcttgaattgcgc
gagcaactgagtgatttgcgcaacagaacggcgagcaatgaccgcctgaaagaacagttg
gttgaattattagagggtatgacgaaaaacgcggaacctgccaaaggagatgcagaatga

DBGET integrated database retrieval system