KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4865Help
Entry
Rahaq2_4865       CDS       T01770                                 

Definition
(GenBank) hemolysin-coregulated protein (uncharacterized)
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEX54582
UniProt: H2J1Y5
Position
pRahaq201:318129..318623
Genome map
AA seq 164 aa AA seqDB search
MSDADNLFMQIEGITGCVSDKKYNGWIAVDYTSNSVFSSAAINNGTGQMNSDGVRFEQVS
FSKEMDATSTDLMNMVAEGTNIKKIIVAMNVKTDNKDNEMVRWTYQNCILTSHQIGASKA
GGIPHETLSFVFGRIEFETQMVEPGGTTKKYGPVGWNIIENTKL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgctgataatttatttatgcaaattgagggtattacaggttgcgtaagtgat
aaaaaatataatggctggattgctgttgactatacgagtaatagcgtgtttagttcagcg
gcaatcaataatggcactggccaaatgaacagcgacggcgttaggtttgagcaggtttca
ttctcaaaagaaatggacgctacttccactgatctgatgaatatggttgctgaaggaacg
aatatcaaaaaaattattgtcgcgatgaatgttaaaacggacaataaagataatgaaatg
gtccgttggacctatcagaactgcatactgaccagccatcaaatcggtgcaagcaaagcc
ggagggatcccacatgagacgctgagtttcgtatttggtcgcattgaattcgaaacccaa
atggtcgagcccggtgggacaactaagaagtatggcccggtaggctggaatatcatagaa
aacaccaagctgtaa

DBGET integrated database retrieval system