KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4873Help
Entry
Rahaq2_4873       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AEX54590
UniProt: H2J1Z3
Position
pRahaq201:325694..326239
Genome map
AA seq 181 aa AA seqDB search
MLGVMLLTGCASDNDQGRQKAISEVAAPFANGAITLKLRAEPGLNSLNEMPNSCTVLLLQ
ARDKPTLDKILGNPATLKSLFAGAGSEGDVLQVDRYVMMPGQTNTVHIDRARDTRNVALV
AGYYPFPMKKHMVSAGVPVESESTGWWEPVWQAHLAPVTLSVTLGSESIVSSDVPVAGEK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgtcatgctgctgacaggttgtgcgtctgataatgatcagggccgtcagaag
gcgatcagcgaagtggctgcgcctttcgccaacggggctatcacgctgaaattgcgggcg
gaaccggggctgaacagcctcaatgagatgcccaacagttgtacggtattactgctgcaa
gccagggataaaccgacgctggataaaattctgggtaaccccgcgacgctgaaaagtttg
tttgctggtgccggcagcgaaggcgacgttttgcaggtagatcgttacgtcatgatgccg
ggacaaaccaacacagtgcatatcgaccgcgccagggatacccgcaatgtggcgctggtg
gcgggctattatccgttcccgatgaagaaacacatggtcagcgcaggggtgccggtggag
tctgaaagtacaggctggtgggaaccagtctggcaggcgcatttagcgccggtcaccctt
tctgtcaccttaggcagtgaaagcattgtcagttcagatgttcctgttgccggagagaaa
aaataa

DBGET integrated database retrieval system