KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4989
Entry
Rahaq2_4989       CDS       T01770                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
KEGG Orthology (KO) [BR:raq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4989
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4989
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AEX54703
UniProt: H2J2A6
Position
pRahaq201:459609..460958
AA seq 449 aa
MKIYRPLWSEGALLSPQQFQQQALWEAHNNQCVAHLSVVNPWGVATAEFDEGLLSVRRLQ
ALQLTVRLPDGSLIDTGSSDLLPPARDLSQDIPAQVNELTVMLAMPLLQANSSNVQLTDN
AGDRPLRYRQEWVNVQDAFGQEEESMAVARYALSLRFDTEQNEEYLICPVLRLVRDGQGG
WRNDSTFIPPLLAMSAHHGLVLDMEQILTQLQAKRRRLMGMRRESNQRMADFAVADVSLF
WLLNALNTHVSALSELVKNPARHPEQVWFELSKLAGSLLTFSLEHDIEAIPAYDHASPET
VFPPLLDLIGELLEASLPSRVISLEMHKINGQQWKAPLNDSRLREDADFYLSVRSTLPAY
QLISQFPALCKVGAPDDVNNIVNIALNGIPLIALSHVPAAIPLRLENQYFTMDLKHPSAQ
AMLDAGTCMFYVPELLGELQLELYAVLRS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaaaatttatcgaccactatggagtgagggggcattgctgtcccctcagcagttccag
cagcaggctttgtgggaagcacataataatcaatgtgttgctcacctgtcggttgttaat
ccctggggtgtagccacagctgaatttgatgagggcttgctgagtgtcagacgtctgcaa
gcacttcaactgaccgtgcgtctgcctgacggttctctgatagataccgggagcagcgat
cttctcccccctgcccgggatttatctcaggatattccggcacaagtcaatgagcttacg
gtgatgctggcgatgccgttattgcaggcaaacagcagtaacgtacaactcactgacaac
gcgggagatcgcccacttcgttatcgtcaggaatgggtaaatgttcaggatgcattcggt
caggaagaagagtccatggctgtggcccgttacgctttgtctctgcgttttgacacagaa
caaaacgaggaatacctgatctgtcctgtattacgtctggttcgcgacggtcaaggcggc
tggagaaatgacagtacatttattcctccgttgctggcaatgtccgctcatcacgggctg
gtcctggacatggagcaaattctcacacaattgcaggctaaacgccgccgcctgatgggg
atgcgtcgtgagagcaatcagcgtatggccgatttcgccgtcgcagatgtgtcattgttc
tggctgcttaatgccctcaatacgcatgtttcagcattatctgaactggttaaaaatccg
gcgcggcaccctgaacaagtctggtttgaattatcgaaactggcggggagtctgctgacg
ttttcccttgaacatgatatcgaggcgataccggcttacgaccacgcgtccccagagacc
gttttcccgcctttacttgacctgatcggggagttactggaagccagccttccttcgcgc
gtaatctcgctggaaatgcacaagatcaacggccagcagtggaaagcgcctcttaatgac
agccgcctgcgcgaagatgcggacttctacctgtcggtgcgctcaacactgcctgcttat
cagctgatttcccagttccctgccttatgcaaagtcggggcaccggacgatgtcaataat
atcgttaatatcgcactcaatggcataccactgatcgctttaagccatgttcctgctgct
attcctcttcgtctggaaaaccagtatttcacaatggatctcaagcatccatctgcgcag
gccatgctggatgcgggtacgtgcatgttctatgtaccggaacttctcggtgaactgcaa
ctggaactctatgcggtgcttcggtcatga

DBGET integrated database retrieval system