KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4992
Entry
Rahaq2_4992       CDS       T01770                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:raq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rahaq2_4992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:raq02044]
    Rahaq2_4992
Secretion system [BR:raq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rahaq2_4992
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEX54706
UniProt: H2J2A9
Position
pRahaq201:463340..463831
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPKMHD
IKDPAKEKHNHLEAIELRYEKITWTYKDGNIIHSDSWNERTTA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctgtggctgaaagacgacggcggtgcggacattaaaggttcc
gtagacgttaaagatcgtgaaggcagcatcgaagtggttgcgcaggatcacaacctgtat
atcccgaccgataacaacaccggcaaactgacgggtactcgtattcacaccccgttcctg
tttaccaaagaaatcgattcttccagcccgtacctgtacaaagcagtgaccaccggtcag
accctgaaatctgctgagttcaaatggtatcgcatcaacgacgcaggccaggaagttgag
tatttcaacaccaaactggaaaacgtcaagctggtgaaagtcgcgccaaaaatgcacgac
ataaaagatccggctaaagagaaacacaaccacctcgaagctattgagctgcgttacgaa
aaaatcacctggacctacaaagacggcaacatcattcattccgattcgtggaacgaacgt
accaccgcgtaa

DBGET integrated database retrieval system