KEGG   Riemerella anatipestifer RA-GD: RIA_0365Help
Entry
RIA_0365          CDS       T02007                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K18221  tetracycline 11a-monooxygenase, tetracycline resistance protein [EC:1.14.13.231]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00253  Tetracycline biosynthesis
rar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    RIA_0365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:rar01504]
    RIA_0365
Enzymes [BR:rar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.231  tetracycline 11a-monooxygenase
     RIA_0365
Antimicrobial resistance genes [BR:rar01504]
 Gene variants
  Tetracycline resistance genes
   Others
    RIA_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 NAD_binding_8 NAD_binding_7 Pyr_redox Pyr_redox_3 2-Hacid_dh_C HI0933_like ApbA NAD_binding_9 IlvN Thi4 3HCDH_N Amino_oxidase Shikimate_DH NAD_binding_2 SE NAD_Gly3P_dh_N TrkA_N F420_oxidored XdhC_C UDPG_MGDP_dh_N Lycopene_cycl Sacchrp_dh_NADP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADZ11542
Position
complement(314599..315759)
Genome map
AA seq 386 aa AA seqDB search
MRIDTDKQMNLLSDKNVAIIGGGPVGLTMARLLQQNGVDVTVYERDKDRDARIFGGTLDL
HRDSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILTTKNVKPENRFDNPEINRNDLRT
ILLNSLQNNTVIWDRKLVALEPDKEKWVLSFEDKPNETADLVIIANGGMSKVRKYVTDTE
VEETGTFNIQADIHQPEINCPGFFQLCNGNRLMASHQGNLLFANPNNNGALHFGISFKTP
DEWKNQTQVDFQNRNSVVDFLLKKFSDWDERYKELIHTTLSFVGLATRIFPLEKPWKSKR
PLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFNSIEEAIENYEQQMFAYGR
EAQEESTQNEIEMFKPDFTFQQLLNV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatagatacagacaaacaaatgaatttacttagtgataagaacgttgcaataatt
ggtggtggacccgttggattgacgatggcaagattgttacagcagaacggtgtggacgtt
acggtctacgaaagagacaaagaccgggatgcgaggatctttggcgggacacttgatctg
cacagggattcgggacaggaagcaatgaaaaaagcagggttgctgcagacgtattatgac
ttagctttgccaatgggtgtaaatattgctgatgaaaagggcaatattttaaccaccaaa
aatgtaaagcccgaaaatcggttcgacaatccagaaataaacagaaatgatttaaggaca
atcttattgaatagtttacaaaacaataccgtcatttgggatagaaaacttgttgccctt
gaacctgataaggagaagtgggtactatcgtttgaggataagccgaacgaaacagcagat
ttggttattatcgccaacggtggaatgtctaaagtaagaaaatatgttaccgacacggaa
gttgaagaaacaggtactttcaatatacaagccgatattcatcaaccggagataaactgt
cctggattttttcagctatgcaatggaaaccggctaatggcatctcaccaaggtaattta
ttatttgctaaccccaataataatggtgcattgcattttggaataagttttaaaacacct
gatgaatggaaaaaccaaacgcaggtagattttcaaaacagaaatagtgtcgttgatttt
ctcctgaaaaaattttccgattgggacgaacgctacaaagaattgattcatacgacgttg
tcatttgtaggattggctacacggatatttcctttagaaaagccttggaaaagcaagcgc
ccattacccataacaatgattggggatgctgctcatttgatgcctccttttgcaggacaa
ggcgtaaacagtgggttgatggatgccttgatattgtcggataatctgaccaatgggaaa
tttaacagcattgaagaggctattgaaaattatgaacagcaaatgtttgcttatggaaga
gaagcacaagaagaatcaactcaaaacgaaattgaaatgtttaaacccgactttacgttt
cagcaattgttaaatgtataa

DBGET integrated database retrieval system