KEGG   Riemerella anatipestifer RA-GD: RIA_0434Help
Entry
RIA_0434          CDS       T02007                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, related enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00010  Glycolysis / Gluconeogenesis
rar00020  Citrate cycle (TCA cycle)
rar00620  Pyruvate metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
Module
rar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RIA_0434
   00020 Citrate cycle (TCA cycle)
    RIA_0434
   00620 Pyruvate metabolism
    RIA_0434
Enzymes [BR:rar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RIA_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADZ11603
Position
386676..388274
Genome map
AA seq 532 aa AA seqDB search
MAEIITMPRLSDTMTEGKVSKWHKQVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYVG
VSEGNAAPVDTILAIIGKEGEDISGLVGGNQSTPQPASSENTSVENTVTEATSSVEIPKG
VEVINMPRLSDTMTEGKVAKWNKNVGDTVKEGDILAEIETDKAVQDFESEFNGTLLYQGV
GEGEAAEVDKILAIIGPAGTDVSAIVSNGGVVSKPQAQQEQSSVASSSKAENVSTSNASV
STDRVAISPLARKMAEEKGIDITNLKGSGENGRIVKKDIENYQPNATEQRSASVTPAAQV
AMNFVAGETTETPNSQVRNVIAKRLSESKFSAPHYYLMVEVNMDKAITARKEINSLPDTK
VSFNDMVIKATAMALRKHPQINSSWAGDKIIHHGSINIGVAVAIPDGLVVPVLKSADFMN
YSQISAGVKDMASRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSCILSVGAI
IEKPVVKDGQIVVGNTMKLSLACDHRVVDGATGAEFLQTLKTYLENPFALLV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataattacaatgcctcgcctttctgatacgatgacagaaggtaaggtttcc
aaatggcataagcaggttggagatgctgtaaaggaaggagatattcttgcagaaatagaa
acggataaagccgttcaagattttgaatcagaggttaacggaacactactttatgtaggt
gtaagtgaaggaaatgcagctcctgtggatactattttggcaattatagggaaagaaggc
gaagatatttcagggcttgtgggcggtaatcaaagtacacctcaaccagcttcatcagaa
aatacttctgtagaaaatacagtaacagaagctacgtcatcagtagagatacctaaaggt
gttgaggtaattaatatgcctcgtctgtctgatacaatgacagaaggtaaagtagctaaa
tggaataaaaatgtgggagatacagtaaaagaaggagatattttagctgaaatagaaaca
gataaagccgttcaagattttgaatcagaatttaacggaactcttttataccaaggtgta
ggagaaggagaagcagcagaagtagataaaatattagccattataggacctgctggaaca
gatgtttctgctatagtttctaatggcggagtggttagtaagcctcaagctcaacaagaa
cagtcaagtgtagcttctagctcaaaagcagaaaatgtttcaacatctaatgctagtgtt
tcaacagatagagtggctatttctccattggctagaaaaatggcagaggagaagggtata
gatattacaaatctaaaaggttctggagagaacggaagaatagtaaagaaagatatagaa
aactatcagccaaacgcaacagaacagcgttctgcttctgtaacgccagctgcacaagta
gctatgaattttgttgctggagaaactacagaaacacctaactctcaagttagaaatgta
atcgcaaaaagactttctgaaagtaagttttcagcacctcattactatttaatggtagag
gtgaatatggataaagccatcactgctagaaaggaaattaactcacttcctgacactaaa
gtatcgtttaacgatatggtgattaaggcgacagctatggctcttagaaagcacccccaa
atcaatagtagctgggcgggagataagattattcatcatggtagcatcaatattggcgtg
gcagtggctatcccagacggattagtagtacctgtattgaagagtgcagactttatgaat
tatagtcaaatttctgcaggagttaaagatatggcttctagagcaaaatctaaaggtctt
aaagctaacgaaatggaaggttctacattctcaatatccaaccttggaatgttcggaata
gaaacatttacttctattatcaatcaaccgaactcttgtatactttcggtaggtgctatt
atagagaagcctgtggttaaagacggacaaattgtagtgggcaatactatgaagttgtct
ttagcatgtgaccaccgtgtggtagatggtgctactggtgcagagtttttacaaacatta
aagacttacctagaaaatccgtttgcattattagtttaa

DBGET integrated database retrieval system