KEGG   Riemerella anatipestifer RA-GD: RIA_1571Help
Entry
RIA_1571          CDS       T02007                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00480  Glutathione metabolism
rar00590  Arachidonic acid metabolism
rar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RIA_1571
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RIA_1571
Enzymes [BR:rar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RIA_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin RuvX
Motif
Other DBs
NCBI-ProteinID: ADZ12659
Position
1577282..1577848
Genome map
AA seq 188 aa AA seqDB search
MKKLFIFILSALALVQCSSKKREVQQDTSKLSKSIYDYKVESLDGGEINFADFKGKKILI
VNTASECGFTPQYEALEKLYQKYKDRLVVVGFPANNFGGQEPGTNTEIKTFCQVNYGVTF
PMAAKVSVKGEDIAPIFQFLTKKELNGVKDTTILWNFTKFLLDENGKIIESYLSTTKPDS
EAITKHLK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctttatattcatactttccgcactcgctttagtgcaatgttctagtaaa
aaaagagaggttcaacaggatacatctaagctttctaaaagtatctacgattataaagtg
gaaagtttagacggtggagaaattaattttgcggatttcaaaggcaaaaaaatacttatt
gtaaatacagcgtctgagtgtggttttacacctcagtatgaagccttggaaaagctctat
caaaaatataaagataggctagtggtagtaggcttccctgctaataactttggaggacaa
gagccaggaactaataccgagattaaaactttttgtcaagtgaactatggagtaactttt
cctatggcagctaaggtttctgtgaaaggagaagatatagcacctatttttcagtttctt
actaaaaaggaattaaacggagttaaagataccaccatactttggaattttaccaaattt
cttctagacgaaaacggaaaaataatagaaagctatctaagtactactaagcctgatagc
gaagcgattacaaaacatttaaaataa

DBGET integrated database retrieval system