KEGG   Riemerella anatipestifer RA-GD: RIA_2091Help
Entry
RIA_2091          CDS       T02007                                 

Definition
(GenBank) Monomeric isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00020  Citrate cycle (TCA cycle)
rar00480  Glutathione metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
rar01210  2-Oxocarboxylic acid metabolism
rar01230  Biosynthesis of amino acids
Module
rar_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIA_2091
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RIA_2091
Enzymes [BR:rar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RIA_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADZ13128
Position
2093637..2095853
Genome map
AA seq 738 aa AA seqDB search
MSTAKIYYTLTDEAPMLATHSFLPIVKAFAKSADIQIEVPDISLSGRILANFPEVLTEEQ
RIPDALSQLGELATKPEANIIKLPNISASIPQLNEAIEELQKKGFNVPNYPAEPKTEEEK
EIKAKYAKVLGSAVNPVLREGNSDRRAPKAVKNYAKANPHRMGEWKSDSKTDVAHMNQGD
FYGTETSTTVEKDGKFKIVFFGNDGSEKVLKDYASLQAGEIIDSSVMNIKALKTFVKEAI
QEAKSRNVLLSAHLKATMMKVSDPIIFGAIVETFFQEVFEKYAETFKSLDVNPNDGLASL
YDKIAGIAQEADIKVDIEHVLNESSRVAMVNSDKGITNFHVPSDVIVDASMAALVRGGGK
MWNKDGQEEDTLAIIPDRSYAGFYQAVIDDMKANGKLDPTTMGSVPNVGLMAKKAEEYGS
HDKTFQMEAEGTVKVLNENNEVLLEQKVETGDIFRMCQTKDAPIQDWVKLAVNRSRLSDT
PAIFWLDKGRAHDREVIKKVEQYLKNYDTQGLDIKILDVKDAMSETLKRAREGKDTISVS
GNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHIEQFIEEGYLRWD
SLGEFLALQASLEHLAQTQNNTKAQVLADALDEANAKFLANDKSPARKIGSIDNRGSHFY
LALYWAEALAAQTQDSELSTLFQPIAKEMQENEAKINEELIASQGKAQDIEGYYRPNEDK
TYAAMRPSVTLNQIIDRI
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagctaaaatttactacacccttacagatgaggctcctatgttagctactcat
tcatttttacctattgtaaaagcatttgcaaaatcagcagacatacagatagaagtaccg
gatatttctttatcagggagaatattggctaactttccagaggttcttactgaagaacaa
agaattcctgatgctttgtctcaattaggagaattagctacaaaaccagaagctaacatt
attaagttgcctaatatttcagcttctatacctcagcttaacgaggctatagaggaacta
cagaaaaaagggttcaatgtacctaattatcctgcagaaccaaaaacggaagaagaaaaa
gaaattaaagctaaatatgctaaggtacttggttcggctgtaaaccctgtgcttagagag
gggaattctgacagaagagctcctaaggctgttaaaaattatgcaaaagccaatcctcat
agaatgggcgaatggaagtctgatagtaaaacagatgtagctcatatgaaccaaggagat
ttctacggtactgaaacttctacgactgtagagaaagatggtaagtttaaaattgtattc
tttggaaatgacggttcagaaaaagtactaaaagattacgcttctcttcaagcaggagaa
attatagactcgtctgtgatgaacatcaaagccttaaaaacttttgtaaaagaggcgata
caagaagctaaaagtagaaatgtattgctttctgctcatttaaaggcaactatgatgaag
gtgtctgaccctattattttcggagctattgttgaaacattcttccaagaagtatttgaa
aagtatgcagaaacattcaaatcattagatgttaatcctaacgatggactggcaagtctt
tatgataaaattgcaggaattgctcaagaagctgatataaaagttgatatagagcatgtt
ctaaacgaaagttctagagtagcaatggtcaactcggataagggaattactaacttccac
gttcctagtgatgttattgtagatgcttctatggcggcattagttcgtggtggcggtaaa
atgtggaataaagatggacaagaggaagatactttagccataattccagaccgttcttat
gctggtttctatcaagctgtaatagatgatatgaaagctaacggaaagttagaccctact
actatgggtagtgtacctaatgtaggactaatggctaaaaaggcagaagagtacggttct
cacgataagactttccaaatggaagcagaaggtactgtaaaagtccttaatgaaaacaac
gaagttttattagaacaaaaggtagaaacgggagatattttcagaatgtgtcaaactaaa
gatgctcctatacaagattgggttaaattagcggttaaccgttctcgcttatcggatact
ccagctatattttggttagataaaggtagagctcacgatagagaagttatcaaaaaagta
gaacaatatcttaaaaattacgatacacaagggcttgatattaaaattttagatgttaaa
gacgcaatgtctgaaactcttaaaagagctagagaaggtaaagacactatttctgtatct
ggcaatgttcttagagattatcttacggatttattccctatcctagagttaggaacctcg
gctaagatgttgtctattgtacctcttatgaacggtggtgggctatttgaaacaggtgca
ggaggttctgctcctaaacatatagagcagtttatagaagaaggctatttacgttgggat
tctttaggagaatttttagcattacaggcaagtttagaacacttagcacaaactcaaaat
aatacgaaggctcaagtattggcagatgcactagatgaagctaatgccaagtttttagct
aatgacaaatctccagctagaaaaataggaagcatagataatagaggttctcatttttat
ttagcgttatattgggcagaagctttagcagcacagactcaagattcagagttatctact
ctgtttcaacctattgctaaagaaatgcaagaaaatgaggcgaaaatcaatgaagagctc
atcgcttctcaaggtaaagcccaagatattgaaggctactatcgtccgaacgaagataaa
acttacgctgcaatgcgtccttcggtaacacttaatcaaattattgatagaatataa

DBGET integrated database retrieval system