KEGG   Riemerella anatipestifer CH3: M949_0029Help
Entry
M949_0029         CDS       T03250                                 

Definition
(GenBank) cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
rat  Riemerella anatipestifer CH3
Brite
KEGG Orthology (KO) [BR:rat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M949_0029
Enzymes [BR:rat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     M949_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Cytochrome_C7 DUF1924 DUF3091
Motif
Other DBs
NCBI-ProteinID: AIH01200
Position
19755..20825
Genome map
AA seq 356 aa AA seqDB search
MQKKYNNFDMRRSNAIFTVLLGAMLVSCTEQVDKGKAEYVFDTSGMSDLMRSANQYFKPV
SITDKGDFSEDMINLGQKLYFDKRLSKNETISCNSCHNLNTFGVDNLPTSPGDTKEFGGR
NSPTVIYASLHSQQFWDGRAKDVEEQAGMPILNPIEHNIPSEKFLEDRLRQIPEYQALFK
KAFPNEAQPITYKNLTKAIGSFERQLLPESRFDKYLNGDENALTQKEKDGLKAFIDNACI
ACHNGSAVGGGSLQKFGVYADYWNYTKSKKVDAGRQDVTKDEKDKFLFKVPSLRNIEKTY
PYFHDGSVASLEEAVRIMSKIQNNKDISDKDVENIVAFLKSLTADIDSKYKTVANK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaagaaatataataattttgatatgagaaggagtaacgctatttttacagtactt
ttaggagctatgttagtaagctgtactgaacaagtggacaaaggaaaagcagagtatgtg
tttgacacttctggaatgtctgatttaatgagaagtgctaatcagtactttaaaccagta
tcaataactgataaaggtgatttcagtgaggatatgattaatcttggtcagaagttatat
tttgacaaaagactttctaaaaatgaaaccattagttgtaattcttgtcataacttaaat
acttttggtgtagataacctgccaacttctcctggagatactaaagaatttggaggacga
aactctcctaccgtgatttatgcttcgctacacagtcagcagttttgggacggaagagct
aaagatgtagaggaacaagcaggaatgcctatcttaaatccgatagaacacaatatccca
tctgagaaattcttagaagacaggttaagacaaatccctgaatatcaagctttatttaaa
aaagcatttcctaatgaagctcagcctattacttataaaaatttaactaaggcgattggt
agttttgagagacaactattacctgaaagtagatttgacaagtatctaaatggagacgaa
aatgcattaacacaaaaggaaaaagatggtctaaaagcctttatagataatgcttgtatt
gcttgccataacggttctgccgtgggtggtggctctttacaaaaatttggagtttatgca
gattattggaactacactaagagtaaaaaggtagatgctggaaggcaagatgtaaccaaa
gacgagaaagataaattcttatttaaagtaccaagtcttagaaatattgagaaaacttac
ccttacttccacgatggttctgtagcttcattagaagaagccgtaagaattatgagtaaa
atacaaaacaataaggatattagcgataaagatgttgaaaatatagttgctttcttgaag
tcgttaacggcagatatagacagcaagtataaaacagtagctaataaataa

DBGET integrated database retrieval system