KEGG   Riemerella anatipestifer CH3: M949_1659Help
Entry
M949_1659         CDS       T03250                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
rat  Riemerella anatipestifer CH3
Pathway
rat00250  Alanine, aspartate and glutamate metabolism
rat00330  Arginine and proline metabolism
rat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M949_1659
   00330 Arginine and proline metabolism
    M949_1659
Enzymes [BR:rat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     M949_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh AIMP2_LysRS_bd
Motif
Other DBs
NCBI-ProteinID: AIH02826
Position
complement(1708199..1709824)
Genome map
AA seq 541 aa AA seqDB search
MSKAISQVPFATNEPVRAYAPGSDEVNSLIATYKKMWAEKVEVPMIINGKEVKTDHKVEM
FSPQDHQHSLGFYYKGDMKTVDEAIETALAAKEKWNALGWEQRASIFLKAADLIAGPYRD
KLNAATMIAQSKNVHQAEIDSACEFIDFLRFNVEFMTELYSEQPVSDNGIWNRSEYRPLE
GFCFAVTPFNFTAISGNLPTCMAMLGNVVVWKPSDKQIYSAKVIMEVLKEAGLPDGVINM
IFTDGKETAEKVLAHPDFAGLHFTGSTKVFQGMWKLIGDNIHNYKSYPRIVGETGGKDFV
VAHPSANVEAVATALVRGAFEYQGQKCSAASRAYIPKSIWNDVKAVMEAQLSTVKVGSPE
DPSNFVNAVIDKNSFEKCKGYIERANQASDAEVVLGGKTDDSKGWFVHPTVILTTNPKYE
SMVEEIFGPILTVYVYEDADWAETLKLVDSTSPYSLTGAIFSQCRYAIDEAYKALENAAG
NFYINDKPTGAVVGQQPFGGGRASGTNDKAGSKMNLLRWVSARSVKETFVSPKDYKYPYL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagctatttcgcaagtaccatttgcaactaatgagcctgtaagagcctatgct
ccagggtctgacgaagtaaactctctaattgccacttataagaaaatgtgggcagagaaa
gtggaagtcccaatgattatcaacggaaaagaggtaaaaacagaccataaggtagaaatg
ttttctccacaagaccaccagcacagcttaggtttctactacaaaggagatatgaaaacc
gtagatgaagctatagaaactgctcttgccgctaaagaaaagtggaatgcactaggttgg
gaacagagagcttctatcttcttaaaagcagcagacctcatcgctggtccttacagagat
aaactgaatgcggctacaatgattgcccagtctaaaaatgtgcatcaggcagaaatagac
tctgcttgtgagttcatagactttttaagatttaatgtagagtttatgacagaactctac
tctgaacagcctgtttctgataacggcatttggaaccgttcagagtaccgtccgctagaa
gggttctgttttgccgtaactccatttaactttactgctatttctggtaacctacctact
tgtatggcaatgctaggaaatgtagtagtatggaaaccttctgacaaacaaatctactct
gcaaaagtaatcatggaggtactaaaagaggctggcttaccagacggtgttatcaatatg
attttcactgacggaaaagaaacagcagaaaaagtattagcacaccctgattttgcaggt
ctccacttcacaggttctactaaagtgttccaaggtatgtggaaactgattggagacaat
atccacaactataaatcttacccaagaatcgttggagaaacaggaggtaaagatttcgta
gttgctcacccatctgctaatgtagaagccgtagccactgctctagtaagaggtgctttt
gaatatcaaggacaaaaatgttcggcagcttctcgtgcttacattcctaaatctatctgg
aatgatgtaaaagcggtaatggaagctcaacttagtactgtaaaggtaggttctccagaa
gacccttctaactttgtgaacgccgtgatagacaaaaactcttttgaaaaatgcaaaggt
tatatcgaaagagctaaccaagctagtgatgctgaagttgtactaggtggtaaaactgat
gatagcaaaggatggtttgtacacccaactgtaatacttactaccaaccctaaatatgaa
agtatggtagaagaaatcttcggacctatccttaccgtttatgtttacgaagatgcagat
tgggctgaaacacttaaattagtagatagcacttctccttattcattaacaggagctatc
ttctcacaatgtcgttatgcgatagacgaggcttataaagcactagaaaacgctgctggt
aacttctatatcaacgataaacctacaggagccgtagtgggacaacagccattcggtggt
ggtagagcttcaggaactaatgataaagctggctctaaaatgaatctacttcgttgggtt
tctgcaagaagtgttaaagaaacttttgtttctcctaaagattacaaatatccttatttg
ggataa

DBGET integrated database retrieval system