KEGG   Riemerella anatipestifer CH3: M949_1731Help
Entry
M949_1731         CDS       T03250                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
rat  Riemerella anatipestifer CH3
Pathway
rat00471  D-Glutamine and D-glutamate metabolism
rat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M949_1731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rat01011]
    M949_1731
Enzymes [BR:rat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     M949_1731
Peptidoglycan biosynthesis and degradation proteins [BR:rat01011]
 Precursor biosynthesis
  Racemase
   M949_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Tn7_Tnp_TnsA_C
Motif
Other DBs
NCBI-ProteinID: AIH02898
Position
complement(1779535..1780350)
Genome map
AA seq 271 aa AA seqDB search
MLVDNLSPKQPIGVFDSGVGGLTVAKEIKRQMPHENIIYFGDTKHLPYGDKSKEAIVRFS
EKIAEFLLEQNCKAIVIACNSATANALKEVKELVGNRAIVFDVVNPVAEKIAYEIHTNVG
VIATKATVNAGIYKKSIRRFNKFIKVDELATPLLVPAIEEGFKNHPITHSILYHYLSNNK
LKNIETLILGCTHYPLLLEEIKQYYGSRVRVIDSPSIVANYIKISLEKHHLLNSEQKTTE
MKFYLSDLTKNFEKISKKFFGKSIDLELKIL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttggtagataacctctctcctaagcaacctataggtgtgtttgattctggagtggga
ggacttaccgtagccaaagaaatcaaaaggcaaatgccccacgaaaacatcatctatttt
ggggataccaaacatttaccttacggagataaatctaaagaagccattgttagattttca
gaaaaaatagccgagtttttgctagagcaaaactgtaaagccatcgtaatcgcttgtaac
tctgccacggctaatgccctgaaagaagttaaagaattggtaggaaatagagcgattgtt
tttgatgtggttaatcctgttgcggagaaaatagcttatgaaatccacaccaatgtaggc
gttattgcaactaaagctaccgtaaatgctgggatttataagaaaagcatcagacgcttt
aacaaatttataaaggtagatgagctagccacaccacttttagttcccgcaatagaggaa
ggttttaaaaatcaccctattacccattctattttatatcattatttgagtaataataaa
ttaaaaaacattgaaacgctgattttagggtgtacgcattatccgctattattggaggaa
attaagcaatattatggtagcagagtaagagtgattgattcacctagtattgtagcaaat
tatattaaaatttctttagaaaaacatcatttacttaattctgaacagaaaacaacagag
atgaagttttatctttcggatttgactaaaaactttgaaaaaatatctaaaaagtttttt
gggaagagtatagatttagaacttaaaatactttaa

DBGET integrated database retrieval system