KEGG   Riemerella anatipestifer CH3: M949_2122Help
Entry
M949_2122         CDS       T03250                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rat  Riemerella anatipestifer CH3
Pathway
rat00020  Citrate cycle (TCA cycle)
rat00310  Lysine degradation
rat00380  Tryptophan metabolism
rat01100  Metabolic pathways
rat01110  Biosynthesis of secondary metabolites
rat01120  Microbial metabolism in diverse environments
rat01130  Biosynthesis of antibiotics
rat01200  Carbon metabolism
Module
rat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M949_2122
  09105 Amino acid metabolism
   00310 Lysine degradation
    M949_2122
   00380 Tryptophan metabolism
    M949_2122
Enzymes [BR:rat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     M949_2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AIH03288
Position
2170445..2171782
Genome map
AA seq 445 aa AA seqDB search
MLKTNKTMAEYKLLLPSMGEGVMEATIISWLFDEGDFVNEDDSVVEIATDKVDSDVPTPV
SGKIVKILKQKDEVAQVGEAIAILETEGGSAVSDTTQEAPKVVETVEEAPSADVIKTIEA
PLNESKVEFSGDLYLSPLVKSIAQEENISEAELKTIKGTGLEGRITKEDILKYVENRGQS
SSSVMKQEVPQVVVPSSASAIPSVPVGTSEGDEVIPMDRVRKIIADSMVRSKHTAPHVSS
FIESDVTNVVKWRNKYKNIFQQREGEKLTFMPIFVRAVVKAIQDYPMINVSVDGDKIIKK
KNINIGMATALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARSKKLKPEDTQGATYTI
SNIGSFGNLMGTPIIPLPQVAILAVGAIVKKPAVLETPEGDVIAIRQKMFMSHSYDHRVV
DGSLGGMFLKAVHDYLENWDLDTEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaaccaataaaacaatggcagaatataaattattacttccttcaatgggagaa
ggcgttatggaagcaactattatttcttggctatttgatgagggtgacttcgtaaacgag
gatgatagtgtagtggaaatagcaacagacaaagtagattcagatgtacctactcctgtt
tcggggaagattgttaaaattttaaaacaaaaagacgaagtagcacaagtaggagaggct
attgcgatattagaaacagaaggtggaagtgcagtatcagatactactcaagaagcacca
aaagtagttgaaacggtagaagaagctcctagtgctgatgttataaaaacaatagaagca
cctctaaatgagtcgaaggtagagttttcaggagatttatatttgtcgcctttagtgaaa
tctattgctcaggaagaaaatatttcggaagctgaattaaaaaccataaaaggaacaggt
ctagaaggtagaattactaaagaagacatattaaaatatgtggagaatagaggtcaatct
tcgtcatctgttatgaagcaggaagtgcctcaggtggtagtacctagtagtgcgtctgcg
ataccttctgtacccgtaggtacttctgaaggagacgaagtgataccaatggatagagtt
agaaaaattattgctgattctatggtgcgtagtaaacacacggctcctcacgtaagttcg
tttattgagagtgatgttactaatgttgtaaaatggagaaataagtataaaaatattttc
caacaaagagaaggcgaaaagctgacttttatgcctatttttgtaagagcggtagtgaag
gctattcaagattatccaatgattaatgtttctgtagatggggacaaaatcattaagaag
aaaaatatcaatataggtatggcaacggctttaccagacggaaaccttattgtacctgta
attaaaaatgcagaccaattatcgttaagtggtttagctaaagctatcaatgatttggct
catcgtgcgagaagcaaaaaactaaaaccagaagatactcaaggcgctacttatactatt
tctaatattggttcttttggtaatttaatggggacgccaattattcctctgcctcaagtg
gctattttagcagtaggagctattgttaaaaaacctgcggtactggaaactccagagggt
gatgtaatagcaattagacagaaaatgtttatgagccactcttatgaccaccgtgtggta
gatggttctctaggtggaatgttcttaaaagcggttcacgattatctagagaattgggat
ttggatacagaaatctaa

DBGET integrated database retrieval system