KEGG   Riemerella anatipestifer CH3: M949_2124Help
Entry
M949_2124         CDS       T03250                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, a subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rat  Riemerella anatipestifer CH3
Pathway
rat00072  Synthesis and degradation of ketone bodies
rat00280  Valine, leucine and isoleucine degradation
rat00650  Butanoate metabolism
rat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M949_2124
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    M949_2124
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M949_2124
Enzymes [BR:rat01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     M949_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIH03290
Position
complement(2172548..2173255)
Genome map
AA seq 235 aa AA seqDB search
MINKTVKNVQEACEGIKDGMTIMLGGFGLCGIPENSIAELVRKNVKNLTCISNNAGVDDF
GLGLLLQKKQIKKMISSYVGENAEFERQLLSGELEVELIPQGTLATRCLAAGYGMPAFFT
PAGVGTEVAEGKEVRNFNGKDYLLEYAFDADFAIVKAWKGDTAGNLIYRSTARNFNPPMA
MAGKITIAEVEELVPAGTLDPDQIHTPGIYVHRIFQGENYEKRIEQRTVRKNNQD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaacagttaaaaatgtgcaggaagcctgcgaaggcatcaaagacggaatg
accattatgcttggtggatttgggctatgtggaatcccagagaatagcattgccgagctg
gtaagaaaaaatgtgaaaaaccttacttgtatttctaataatgcaggtgtggatgatttt
ggactaggacttttacttcaaaagaagcaaattaaaaaaatgatttcttcctatgtggga
gaaaacgccgaatttgaaagacaattactaagcggagagttagaagtagaacttatccca
caagggactttggctactagatgtttggctgcggggtatggtatgcctgctttttttaca
cctgctggtgtagggacagaagttgctgagggtaaggaagtcagaaactttaatggtaaa
gattatcttttagagtatgcttttgatgctgattttgccatcgttaaagcttggaaaggc
gacacagcaggaaatttaatctatcgttctaccgctagaaattttaatccaccaatggca
atggctggtaaaattacgattgcagaggtagaagagctcgtacctgcgggaacattagac
cctgaccaaatacatactcctgggatttatgtacaccgtatcttccaaggagaaaactac
gaaaagagaatagagcaaagaaccgtaagaaaaaataatcaagactaa

DBGET integrated database retrieval system