KEGG   Rickettsia australis: MC5_02035Help
Entry
MC5_02035         CDS       T01783                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rau  Rickettsia australis
Pathway
rau00071  Fatty acid degradation
rau00072  Synthesis and degradation of ketone bodies
rau00280  Valine, leucine and isoleucine degradation
rau00310  Lysine degradation
rau00362  Benzoate degradation
rau00380  Tryptophan metabolism
rau00620  Pyruvate metabolism
rau00630  Glyoxylate and dicarboxylate metabolism
rau00640  Propanoate metabolism
rau00650  Butanoate metabolism
rau00900  Terpenoid backbone biosynthesis
rau01100  Metabolic pathways
rau01110  Biosynthesis of secondary metabolites
rau01120  Microbial metabolism in diverse environments
rau01130  Biosynthesis of antibiotics
rau01200  Carbon metabolism
rau01212  Fatty acid metabolism
rau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC5_02035
   00630 Glyoxylate and dicarboxylate metabolism
    MC5_02035
   00640 Propanoate metabolism
    MC5_02035
   00650 Butanoate metabolism
    MC5_02035
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC5_02035
   00072 Synthesis and degradation of ketone bodies
    MC5_02035
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC5_02035
   00310 Lysine degradation
    MC5_02035
   00380 Tryptophan metabolism
    MC5_02035
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC5_02035
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC5_02035
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC5_02035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rau04147]
    MC5_02035
Enzymes [BR:rau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC5_02035
Exosome [BR:rau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC5_02035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC70794
UniProt: H8K9S4
Position
complement(377190..378368)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFMGSLSTTSAPMLAAHLIKDMIQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKSVALAANSIMTGDNELVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQEQDEFAL
SSHKKASKAQLAGIFKDEILPIEVTVKKTTSLFEHDETVRHDTSLEILSKLCPAFDKSGI
VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASAGVDPSIMGTAPVPAAQKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMDKVNINGGAIAIGHPIGASGGRVLIT
LIHSLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggacggcgttcggctcgtttatgggt
agtcttagcacgacttcagcaccaatgctagctgctcatttaataaaagatatgatacaa
aacagcaaaatcgatccagctttagtaggtgaggtaatacttggacaagtaataacaggc
ggtagcgggcagaatccggcgaggcaaactctgattcatgcggggatacctaaagaagtg
ccgggttatacgattaataaagtatgtggctcaggtcttaaaagcgtagcacttgcagca
aattcgattatgactggtgataatgagctagttatagcaggtgggcaagagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggactaactgatgtattttcaggagtatttatgggcattact
gccgaaaatatctcgaaacagtttaatattagtagacaagagcaagatgaatttgcttta
agttctcacaagaaagcatctaaagcacagctagccggaatttttaaagatgaaatttta
cctatcgaagtaacggtaaaaaaaactactagtttgtttgaacatgatgaaacagtaaga
catgatacaagccttgaaattctgagtaaattatgtcctgcttttgataaaagcggcata
gttacggcgggtaatgcttcttcaatcaatgacggtgcggcatgccttatggtagtttct
gaagaagcattgaaaaagcataatttgatgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccccgtgcctgccgcccaaaaggcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaagcgtttgct
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggataaggttaacataaat
ggcggtgcaatagcaatcgggcatccgattggggcaagcggcggacgtgttcttataact
ctgatacactctttaagaagagctaaagctaaaaaaggcttagtcaccttatgtatcgga
ggcggtatgggtatggctatgtgcgttgaagcagtttaa

DBGET integrated database retrieval system