KEGG   Rickettsia australis: MC5_02315Help
Entry
MC5_02315         CDS       T01783                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rau  Rickettsia australis
Pathway
rau00460  Cyanoamino acid metabolism
rau00500  Starch and sucrose metabolism
rau01100  Metabolic pathways
rau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MC5_02315
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MC5_02315
Enzymes [BR:rau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     MC5_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AFC70845
UniProt: H8K6F2
Position
421694..422683
Genome map
AA seq 329 aa AA seqDB search
MTIRQRAKPVIIGISGPELTDAERELFEEHNPLGVILFRRNIRKNDNGEQDKETLIKLIA
DIKEVLGENTIISIDQEGGRVKRLIAPTFYDAPAAQTFVDVQECKQNYINIGKELREVGI
NLDFAPVADLIHEGADKIVGDRSFGSGLEVVVPLCLAAIDGLQEEKVVACIKHIPGHGRA
KVDSHIGLPIVDTSLKELEDTDFKVFKELAKHDNIKLAMTAHIIYKALDPENPATLSKKV
QAYIKNNIGFKGLIISDAIDMKALSGSMADITKGVLDAGVDIVLECTGAFNKMSEVLGSV
SEDSIDKFSDLLMFLWGMQNPLPLGEGKI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagacaaagagcaaaaccggtaattataggtatatccggtcctgaattaacc
gatgctgaaagagaattatttgaagagcataatcctttaggtgtaattttattccgtcgt
aatattagaaagaatgataacggtgagcaggataaagaaactcttattaagcttattgca
gatataaaagaagtattaggagaaaatactatcatctctatagatcaagagggaggtagg
gtaaaaaggctcatagcaccaactttttatgacgctccggctgctcaaactttcgttgat
gtgcaagagtgcaaacaaaactatatcaatataggcaaagagctaagagaagtaggtatt
aatctagattttgctccggtagcggatttgatacacgaaggagcagacaagatagtcggc
gatagaagtttcggctcagggctggaagtagtcgtgcctttatgtttagctgctatagat
ggattacaagaagagaaagtcgtggcttgtataaaacatattcctggtcatggtagagct
aaagtggatagccatatagggttacctattgttgatactagcttaaaagaactagaggat
acagactttaaagtatttaaggagctagcgaagcacgataatattaaacttgctatgacg
gcacatataatttataaagctcttgatcctgagaaccctgccaccctatccaaaaaagtt
caagcctatattaaaaataatataggctttaaagggcttattatttccgatgcaatagat
atgaaagctttaagcggtagtatggcagatattaccaaaggagttttagatgcaggtgta
gatatagtgcttgaatgtaccggagcatttaacaaaatgtctgaagttctaggtagtgtt
tcggaagattctatagataaattttctgaccttttaatgttcctatgggggatgcaaaat
cccttgcctttaggcgaagggaagatataa

DBGET integrated database retrieval system