KEGG   Rickettsia australis: MC5_04890Help
Entry
MC5_04890         CDS       T01783                                 

Definition
(GenBank) PetR protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rau  Rickettsia australis
Pathway
rau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC5_04890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rau02022]
    MC5_04890
Two-component system [BR:rau02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   MC5_04890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFC71269
UniProt: H8K7M6
Position
861185..861865
Genome map
AA seq 226 aa AA seqDB search
MQPHKAHILIVDDDSRILALLKQFLNKNELLVSTASSVIEAKNLLKNSNYDLIILDVMLP
EITGLDFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYITKPFEPRELLLRINNL
INNYNNFKKETNIIKFGNNFYNFDTKEFTKNDQIIPLSSTEQKLLEILIKNSGKSTSRFE
LSKIMGGLSMRSIDVQITRIRGKIEDNPKEPKYLKTVRNEGYALYI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccacataaagcacatattttaatcgtagatgatgatagcagaatattagcactt
ttaaagcagtttttaaataaaaacgagcttttagtatcaacggcaagctcagtcatagaa
gctaaaaatctattaaaaaattctaattatgatttaattattttagatgttatgttacct
gaaataacaggacttgattttgctactactataagggatgccggtaataatattcctata
gttatgcttactgctttatcggaagccgatgaccgtgttaaaggacttgaagctggtgcc
tctgattatataactaaaccttttgaaccgagagaattattacttcggataaataattta
attaataattataataactttaaaaaagaaacgaatataattaaattcggcaataatttc
tataattttgatacaaaggaattcactaagaacgatcaaatcatacctcttagctctacc
gaacaaaaattacttgagatattaataaaaaattccggtaaatctactagtcgttttgaa
ctttcaaaaataatgggaggtcttagtatgcgttctatcgatgtacaaattacaagaata
agaggcaaaatagaagacaacccaaaagagccaaaatatttaaaaaccgtgcgtaatgag
ggctatgcactttatatttga

DBGET integrated database retrieval system