KEGG   Rhodococcus aetherivorans: AAT18_04405Help
Entry
AAT18_04405       CDS       T03876                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rav  Rhodococcus aetherivorans
Pathway
rav00072  Synthesis and degradation of ketone bodies
rav00280  Valine, leucine and isoleucine degradation
rav00650  Butanoate metabolism
rav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAT18_04405
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AAT18_04405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAT18_04405
Enzymes [BR:rav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AAT18_04405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans NPH-II
Motif
Other DBs
NCBI-ProteinID: AKE88586
UniProt: A0A059MUB9
Position
complement(953167..953934)
Genome map
AA seq 255 aa AA seqDB search
MGTKVFDTPAAAVADVSDGATIAVGGFGLCGIPDALIRALVESGVGDLEVFSNNCGVDDH
GLGLLLNARQIRRVTASYVGENKEFARQYLAGELEVELTPQGTLAERLRAGGAGIPAFFT
PAGVGTPVADGGLPWRYHVDGSVAVASPPKETRAFGDKRYVMEEGITADFALVHAVKGDT
AGNLIFDKTAMNFNPLAAMAGKVTIAQVEELVEPGELDPAQVHLPGIFVQRIVETGPQDK
RIEKRTVQATEGAAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaaagtgttcgacacgcccgcggccgccgtcgcggacgtgtccgacggcgcg
acgatcgccgtcggcgggttcgggttgtgcggcatccccgacgccttgatccgcgcgctg
gtcgagtccggcgtcggcgatctcgaggtgttctccaacaactgcggcgtcgacgaccac
ggcctgggcctgctgctgaacgcgcgccagatccgccgggtcaccgcctcctacgtcggg
gagaacaaggagttcgcccgccagtatctcgccggtgagctcgaggtcgagctcaccccg
cagggcaccctcgccgagcggctgcgcgccggtggcgccggcatccccgcgttcttcacc
ccggcgggtgtcggcacccccgtcgcggacggcggactgccgtggcggtaccacgtcgac
ggctcggtggccgtggcctccccgccgaaggagacccgggccttcggcgacaagcggtac
gtgatggaggagggcatcaccgccgacttcgcgctggtgcacgccgtcaagggcgacacc
gccggcaacctgatcttcgacaagacggcgatgaacttcaacccgctggccgcgatggcc
gggaaggtcacgatcgcgcaggtcgaggaactcgtcgagcccggcgagctcgatcccgcg
caggtgcacctgccgggaatcttcgtgcagcgcatcgtcgaaaccggtccgcaggacaag
cggatcgagaagcggacagtccaggcaacggaaggggcggcacgatga

DBGET integrated database retrieval system