KEGG   Rhodococcus aetherivorans: AAT18_19125Help
Entry
AAT18_19125       CDS       T03876                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rav  Rhodococcus aetherivorans
Brite
KEGG Orthology (KO) [BR:rav00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AAT18_19125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HCMV_UL124 DEC-1_N OAD_gamma
Motif
Other DBs
NCBI-ProteinID: AKE91001
Position
4270963..4272195
Genome map
AA seq 410 aa AA seqDB search
MTAELVVLLVVVVTALAFDFTNGFHDTGNAMATSIATGALKPKVAVALSASLNLVGAFLS
VEVAATVAKGVVNLGSTGGEALLLIVFAGLVGGILWNLATWLFGLPSSSSHALFGGLIGA
ALASLGIDGVVWDGVIGKVIIPALLAPVVAALVATVGTWSVHRITRTVPDETRGHGFRIG
QIGSASLVSLAHGTNDAQKTMGVIFLALVAHGSLTADAEMPFWVKLSCAVAIALGTYLGG
WRIIRTLGKGLVEIAPPQGMAAESSSAAIILTSSHFGLPLSTTHVATGSILGSGLGTRSA
NVRWGVAGRMAVAWLITLPSAALVGAVCWGLAHLIGGLPGVILVFAVLCALSLLMYLRSR
RQPIDASNVTAEWDGKLAPAPAPAPAPIPTPAPAPEDVPAAPTTPTEGRP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagagcttgtcgtcctcctggtggtggtagtcactgccctcgcattcgacttc
accaacggcttccacgacaccgggaacgcgatggcgacatcgatcgccaccggtgccctg
aaaccgaaggtggcggtcgccctctccgcctcgctcaacctcgtcggcgcgttcctgtcc
gtcgaggtcgccgcgacggtcgccaagggggtggtcaacctgggcagcaccggcggcgag
gcactgctgctcatcgtgttcgccggtctcgtcggcggcatcctgtggaacctggcgacg
tggctgttcggcctgccgtcgagctcgtcgcacgcactgttcggcggcctcatcggcgcc
gccctcgcctccctcgggatcgacggcgtggtgtgggacggagtgatcggcaaggtgatc
atcccggcgctgctggcgccggtggtggcggcactcgtcgccacggtcggcacctggtcg
gtgcaccgcatcacccgcacggtgcccgacgagacccgcggtcacggcttccgcatcggc
cagatcggttccgcctccctggtgtcgctggcgcacggcaccaacgacgcgcagaagacg
atgggcgtgatcttcctggcgctcgtcgcgcacggcagcctcaccgccgacgcggagatg
ccgttctgggtgaagctctcctgcgccgtcgcgatcgccctgggcacctacctcggtggc
tggcgcatcatccgcaccctcggcaagggactggtcgagatcgcaccgccgcagggcatg
gcggcggagtcgtcgtcggccgcgatcatcctcacctcgagccacttcggtctgcccctg
tcgaccacccacgtggcgaccggttcgatcctggggtccggactcggcacccgctccgcg
aacgtgcgctggggcgtcgccggccgcatggccgtcgcctggctgatcacgctgccgtcc
gcggcgctcgtcggcgcggtgtgctggggtctggcccacctgatcggcggcctgccgggc
gtgatcttggtgttcgcggtgctgtgcgcgctgtcgctgctgatgtacctgcggtcacgc
cggcagccgatcgacgcctccaacgtcaccgcggaatgggacggcaagctggctccggct
ccggctccggccccggccccgatcccgaccccggcgccggcccccgaggacgtgccggcc
gcaccgaccactcccacggagggacgcccgtga

DBGET integrated database retrieval system