KEGG   Rhodococcus aetherivorans: AAT18_22420Help
Entry
AAT18_22420       CDS       T03876                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rav  Rhodococcus aetherivorans
Pathway
rav00071  Fatty acid degradation
rav00072  Synthesis and degradation of ketone bodies
rav00280  Valine, leucine and isoleucine degradation
rav00310  Lysine degradation
rav00362  Benzoate degradation
rav00380  Tryptophan metabolism
rav00620  Pyruvate metabolism
rav00630  Glyoxylate and dicarboxylate metabolism
rav00640  Propanoate metabolism
rav00650  Butanoate metabolism
rav00900  Terpenoid backbone biosynthesis
rav01100  Metabolic pathways
rav01110  Biosynthesis of secondary metabolites
rav01120  Microbial metabolism in diverse environments
rav01130  Biosynthesis of antibiotics
rav01200  Carbon metabolism
rav01212  Fatty acid metabolism
rav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAT18_22420
   00630 Glyoxylate and dicarboxylate metabolism
    AAT18_22420
   00640 Propanoate metabolism
    AAT18_22420
   00650 Butanoate metabolism
    AAT18_22420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAT18_22420
   00072 Synthesis and degradation of ketone bodies
    AAT18_22420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAT18_22420
   00310 Lysine degradation
    AAT18_22420
   00380 Tryptophan metabolism
    AAT18_22420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAT18_22420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAT18_22420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAT18_22420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rav04147]
    AAT18_22420
Enzymes [BR:rav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAT18_22420
Exosome [BR:rav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAT18_22420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AKE91537
UniProt: E5G6W8
Position
complement(5007326..5008639)
Genome map
AA seq 437 aa AA seqDB search
MTTTARSTQLRRVAILGGNRIPFARSDRTYARASNQDMFTATLDGLVSRFNLQGERLGAV
VGGAVLKHSRDFNLIRECVLGSALNPHTPAWDLQQACGTGLQSIISVGDAVAAGRIEAGI
GGGVDTTSDAPIGVNNELREFLLSLNRARSTGDRVKLLGQVRPSMLGIEIPRNGEPRTGL
SMGEHAAITAKEFGIAREAQDELAAASHRNMAAAYDRGFFDDLVTPFLGLTRDDNLRPDS
TVEKLSGLKPVFGVELGGATMTAGNSTPLTDGASAALLSSEEWAAERRLPVLAYLVDSET
AAVDYVHGGDGLLMAPTYAIPRLLKRNGLTLQDFDFYEIHEAFASVVLATLQAFESEEYC
KGRLGLDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRIVASLAKMLHEKRQETGKPVRGL
ISICAAGGQGVTAILEA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccgctcgttccacgcagctgcgccgtgtcgcaatcctcggcggcaaccgg
atccccttcgcccggtcggaccgcacgtacgcccgcgcgtcgaaccaggacatgttcacc
gccacgctcgacgggctggtgagccggttcaacctccagggcgagcggctcggtgccgtc
gtcggcggggccgtcctcaagcacagccgcgacttcaacctgatccgcgagtgcgtactc
ggcagcgcgctgaacccgcacacccccgcctgggacctgcagcaggcctgcggcaccggc
ctgcagtcgatcatctccgtcggtgacgccgtcgccgccggccgcatcgaggccggcatc
ggcggcggtgtcgacaccacctccgatgcccccatcggcgtcaacaacgagctgcgcgag
ttcctgctctccctcaaccgggcccgctcgaccggcgaccgcgtcaagctgctcggccag
gtccggccgtcgatgctcggcatcgagatcccccgcaacggcgagccccgcaccggactg
tcgatgggcgagcacgcggcgatcaccgccaaggagttcggcatcgcccgggaggctcag
gacgagctggccgccgcgagccaccgcaacatggccgccgcctacgaccgtggcttcttc
gacgacctcgtcaccccgttcctcggcctcacccgcgacgacaacctgcgcccggactcg
acggtcgagaagctctccggcctgaagccggtgttcggcgtcgagctcggcggcgccacc
atgaccgcgggcaattcgaccccgctcaccgacggtgcgtcggcggcgctgctgtcctcg
gaggagtgggctgcggagcgcaggctgcccgtgctcgcctacctcgtggactcggagacc
gcggcggtcgactacgtccacggtggcgacggcctgctcatggcccccacctacgcgatc
ccgcggctgctgaagcgcaacggcctgacgctgcaggacttcgacttctacgagatccac
gaggcgttcgcctccgtcgtcctggccacgctccaggcgttcgagtcggaggagtactgc
aagggccggctcggtctggatgctccgctcgggtccatcgaccgcagcaagctcaacgtc
aacggctcgtcgctggcggccgggcacccgttcgccgcgacgggtggccgcatcgtcgcg
tccctggcgaagatgctgcatgagaagcggcaggagaccggcaagcccgtgcggggcctc
atctcgatctgcgccgcaggtgggcagggtgtgaccgccatcctcgaggcctga

DBGET integrated database retrieval system