KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497149Help
Entry
107497149         CDS       T06036                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00480  Glutathione metabolism
ray00590  Arachidonic acid metabolism
ray01100  Metabolic pathways
ray04918  Thyroid hormone synthesis
ray05014  Amyotrophic lateral sclerosis (ALS)
ray05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107497149 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107497149 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107497149 (GPX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    107497149 (GPX3)
   05016 Huntington disease
    107497149 (GPX3)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107497149 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 107497149
NCBI-ProteinID: XP_015974190
Position
Unknown
AA seq 225 aa AA seqDB search
MAWLLRASCLLSLLLAGFVPLSRGQKSKVDCHAGMSGTIYDYGALTIDGQEYIPFKQYAG
KYVLFVNVATYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGDNSEILPALKY
VRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCLPTSELLGSPNSLFWEPMKNHDIRW
NFEKFLVGPNGIPIMRWHHRTTVSNVKMDILAYMRRQAAQGIRGK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggctgctccgcgcatcctgccttctctctctcctcctggccggcttcgtcccg
ctaagccgggggcagaagtcgaaggtggactgccatgctggcatgagtggcaccatctac
gactacggagccctcaccatcgacgggcaggaatacatccccttcaagcagtatgctggc
aaatacgtcctctttgtcaacgtggccacctactgaggcctgacgggccagtacattgaa
ctgaatgcactacaagaagagcttgcaccatttggtctggtcattctgggcttcccctgc
aaccaatttggaaaacaggagccaggagacaactcagagatcctacctgccctcaagtat
gtgagaccaggtgggggctttgtccccaatttccaactctttgagaaaggagatgtgaac
ggggagaaagagcagaagttctacacgttcctgaagaactcctgtctccccacctcggag
ctcctgggctcacctaacagcctcttctgggaacccatgaagaaccatgatatccgctgg
aactttgagaagttcctggtgggaccaaacggcatacccatcatgcgctggcaccaccgg
accacggtcagcaatgtcaagatggacatcctggcctacatgaggcggcaggcagcccag
gggatcagggggaagtaa

DBGET integrated database retrieval system