KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498354Help
Entry
107498354         CDS       T06036                                 

Gene name
FANCD2
Definition
(RefSeq) Fanconi anemia group D2 protein isoform X1
  KO
K10891  fanconi anemia group D2 protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107498354 (FANCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107498354 (FANCD2)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     107498354 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 107498354
NCBI-ProteinID: XP_015976857
Position
Unknown
AA seq 1450 aa AA seqDB search
MVSKRRLSKSEDKESPTEDASNARKPPLSKKTKKSHIHNEVDENNSIFIQLLKTSGIILK
TGENQNQLAVDQIVFQKKLFQTLRKHPSYPRIIEEFVSGLESYIEDQDSFRNCLLSCERL
QDEEASMGTPYSKSLIKLLLGIDILQPAIIKTLFEKLPEFLFERVNSNGISMPRLIISQL
KWLDRVVDGKDLTTKIMQLISIAPVHLQHDFITSLPEILGDSQHADVGQELSDLLTENTP
LTVPILDVLSSLRLDPELLSKIRQLMISKLSSVRLDDLPVIIKFILHSVTTTDALEVISE
LREKLDLQQCILPSRLHASQSKMKNKGQTSSSGNQENSGQDCVFLLFDVIKSAVRYEKTI
SEAWIKAIERTAPMSEHKIFDLTMLLIIYSTNTQTKKCIERVLRNKIRSGCFQEELLQST
FYIHYFVLKDLCPSILSLAQNLLHSLDQSIILFGSLLYKYAFKFFDAYCQQEVIGALVTH
ICSGNEAEVDIALDVLLELAVLNLSAMRMNAVFVKGILDYLDKMSPRQIRKLFYILSTLA
FSNQHEGSSHIQDDMHLVVRKQLSSTIFKYKLIGIIGAVTMAGIMAADRSRSSSLTQRKA
DLSNEQYTQVTSLLQLVHSCSEQSPRASALYYDEFANLIQGGKLAPKALEWVGQTIFNDF
QDAFVVDLHVVPEGEYPFPVKALYGLEEYSSVDGIAINLLPLLFYQDFATDGGRTTSQES
DHKLVSPLCLPPYFRLLRFCVAGQHNGNLEEIDGLLDCPIFLTDLEPGEKLESMSVKERS
FMCSLIYLTLNWFREVVNAFCWQMSPEIKGKVLTRLKHIVELQKILEKYLAVTPDYVPPL
ATFDLETVDVIPQTSTAVSTKIRKQGTIGGRKCKAGGNKTSSCDTFSKEDGSECDPTPSD
RGHLEKEFKKKEEKTVSLQNYHAFFRELDMEVFSILHCGLVTKFILDSEMHTKATEIVQL
QPPELLFLLEDLSNKVENMLTPSIARRVPFLKNKGNQNIGFSHLHQRSAQEIARCIVQLM
TPMCNHLENIHNYFQCLAAENHGMVDGPGMQDREYHLMSSCYQRLLQIFHGLFAWSGFFQ
PENHNLLYLALEVLTNRLKQREPDQPLEELLSQSFHYLQNFHCSVPSFQSALYLLRLLMV
ILEKSTAPAQKKEKIASLARQFLCRLWPNGEKEKSSIPNDELHALLGIYLEHTDSVLKAI
EEIAGVGVPELISSSKDASSTFPTLTRQTFVIFFRVMMGELEKTVKTIQAGTAADSQQIH
EEKLLYWNMAVRDFSILINLIKVFDSRPVLHICLKYGRLFVEAFLKQCMPLLDFSFRKHR
EDVLSLLETFQLDTRLLHHLCGHSKIHQDTKLTKHVPLLKKILELLVCRVKAMLILNNCR
EAFWLGNLKNRDLQGEEIISQNSQESTANESEDDTSSQVSKSKAVENGEEDEASDGEKEQ
DSDETDDDSD
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atggtttccaaaagaagactgtcaaaatccgaggataaagagagccctacagaagatgcc
tctaatgccaggaagccaccactttccaaaaagacaaagaaatctcatattcataatgaa
gttgatgaaaacaacagtatattcatacagcttcttaagacctcaggaattattcttaaa
acaggagagaatcagaatcaactagctgtggatcaaattgttttccaaaagaagctcttt
cagactctgaggaaacatccttcttatcccagaataatagaagaatttgttagtggcctg
gagtcgtacattgaggaccaagacagtttcaggaattgccttttgtcttgtgaacgtctg
caggatgaagaagccagcatgggcacaccttactctaagagcctcattaaattgcttctg
gggattgacatattacagcctgctattatcaaaaccttatttgaaaagttgccagaattt
ctttttgaaagagtgaacagtaatggaataagcatgcctcgactcatcatcagtcaactg
aaatggcttgacagagttgtggatggcaaggatctcaccaccaagattatgcagctaatc
agtattgctccagtgcaccttcagcatgacttcattactagcctacctgagatcctaggg
gattcccaacatgctgatgtggggcaagaactcagtgaccttctaacagagaacacacca
ctcactgttccgatcctggatgtcctttccagcctccgacttgacccagagctcctgtct
aagatccgccaattgatgataagtaagttgtcatctgtcagactggacgatttacctgtg
ataatcaagttcattcttcattctgtaacaaccacggatgcacttgaggtaatttctgaa
cttcgggagaagttggatctgcagcaatgtattttgccttcacggttacatgcttcccaa
agcaagatgaaaaataaaggacaaacaagttcttcaggaaatcaagaaaacagtggtcag
gactgtgtttttcttctctttgatgtgataaagtcagctgttagatatgagaaaaccatt
tcagaagcctggattaaggcaattgaacgcactgctccaatgtctgaacacaagatattt
gacctgacgatgcttctcatcatctatagcaccaacactcagacaaagaagtgcattgag
agggtgctaagaaataagattcgatcaggctgctttcaagaagagctgcttcagagtaca
ttctatattcattactttgttcttaaggatctttgtccatccattctgtcgctggctcag
aatttgttgcactccctagaccagagtataattttgtttggcagtctgctatacaaatat
gcatttaagttttttgacgcttactgccagcaggaagtgattggtgccctagtgacccat
atctgcagtgggaatgaagctgaagttgatattgcattggatgttctcctagagttggca
gttctaaacctatctgctatgaggatgaatgctgtctttgtgaagggcattttagattat
ctggataaaatgtcccctcggcaaatacgaaaactcttctatattctcagcacactggca
tttagcaatcagcatgaaggcagcagtcatatccaggatgacatgcacttggtggtacgg
aagcagctctccagcaccatattcaagtacaaactcattggtatcattggtgctgtcacc
atggctggtatcatggcagcagacagaagtagatcttccagtttgacccagaggaaagca
gacctgagcaatgaacagtacacacaggtgacctccttgctgcagttggttcattcctgc
agtgagcagtctcctagggcctctgcactttattatgatgaatttgccaacctgatccaa
ggaggaaagctggctccgaaagccctggaatgggttgggcagaccatctttaatgatttc
caagatgcttttgtggtggacttgcatgttgttccagaaggtgaatatccgtttcctgtg
aaagctctctatggactagaagaatacagtagtgttgatggaattgccatcaacctcctg
ccactgttgttctatcaggactttgcaactgatgggggtagaacgacttcacaggaatca
gaccacaaattggtgtctccgttgtgcctgcctccctatttccgattgctgagattttgt
gtggcgggacaacataatggaaacttggaggagatcgatggtttattagattgtcctata
ttccttactgacctggagcctggagagaagctggagtccatgtctgttaaagagcgctca
ttcatgtgttcactcatatatcttactctcaactggttccgagaggttgtaaatgccttc
tgctggcaaatgtcacctgagattaaggggaaggtgctcacccggttaaagcacatcgta
gaacttcagaaaattctggaaaagtatttggcagtcaccccagactatgttcctcccctt
gcaacctttgacttggaaactgtcgatgtaatacctcaaaccagtactgctgtttcaaca
aaaatcagaaaacaaggaacgataggaggaaggaaatgtaaagcaggtggcaacaaaaca
tcttcctgtgacacattttcaaaggaggatggttcagaatgtgaccctacaccatctgat
agaggccacctggaaaaggagttcaaaaaaaaagaagaaaagacagtgtcgctacagaat
tatcatgcttttttccgagagctggacatggaggtcttctctattctgcattgtgggctt
gtgaccaagttcatcttagactctgaaatgcacactaaagctacagaaattgtgcaactt
cagccccccgagctgcttttcttactggaagatctctccaacaaggtggagaatatgctg
acaccttctattgccaggagagtccccttcctcaagaataaaggaaaccagaatattgga
ttctcacatctccatcagagatctgcccaagaaattgcccgttgtattgttcaactgatg
accccaatgtgtaaccatctggagaatattcacaactattttcagtgcttagctgctgag
aatcatggtatggttgatggaccgggaatgcaagatagggagtaccacctaatgtcttct
tgctatcagaggctactgcagatttttcatgggctttttgcttggagtggattttttcaa
cctgaaaatcataatttactatacttagccctcgaggtccttactaaccgactgaagcag
agagagcctgaccagcccttggaggaactgctcagccagagcttccattacctgcagaat
tttcattgcagcgttcccagtttccagtctgctctttatctcctcagacttttgatggtc
attttggagaaatctacagctcctgcccagaaaaaagaaaaaattgcttccctggccaga
cagttcctctgtcggttgtggccaaatggggagaaagagaagagcagcatccctaatgac
gagctgcatgctttgcttggcatctacctggagcacacagacagtgttctgaaggccata
gaggagattgctggtgttggtgtcccagaactgatcagctcttctaaagatgcatcttcc
acattccctactctgaccaggcagacctttgtcatttttttccgtgtgatgatgggtgaa
ctagagaagacagtgaaaactattcaggctggcacagcagcagactcgcagcagattcat
gaagagaagcttctctactggaatatggctgttcgagactttagtatcctcatcaacctg
ataaaggtttttgatagtcgtcctgttctacatatatgtttgaagtatgggcgtctcttt
gtggaagcatttctgaagcagtgtatgccgctcctagacttcagttttagaaaacaccgg
gaagatgttctgagtttactggaaaccttccagttggacacaaggctgcttcatcacctg
tgtgggcattccaagattcaccaggatacgaagctcaccaaacatgtgcctttgctcaaa
aagatcctggagctgttagtttgcagagtgaaagcgatgctcatccttaacaattgcagg
gaggctttctggctgggaaatctcaaaaaccgggacttacagggtgaagagattatatcc
cagaattcccaggaaagcacagcaaatgagagtgaggatgacacatcatcccaggtctcc
aagagcaaagcagtggagaatggtgaagaagatgaagcaagtgatggagaaaaggagcaa
gatagcgatgagaccgatgatgactctgattag

DBGET integrated database retrieval system