KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499953Help
Entry
107499953         CDS       T06036                                 

Definition
(RefSeq) sodium/hydrogen exchanger 3-like
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-GeneID: 107499953
NCBI-ProteinID: XP_015980142
Position
Unknown
AA seq 344 aa AA seqDB search
MGDLDIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYTV
FESFIALGGDEVTGVDCVKGIVSFFVVSLGGTLVGVLFAFLLSLVTRFTKHVRIIEPGFV
FVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETII
FMFLGISAVDPLIWKWNTAFVLLTLVFISVYRAIGVVLQTWVLNRYRMVQLEVIDQVVMS
YGGLRGAVAFALVVLLDESKVKEKNLLVSTTIIVIYFTFQLGGLTIKPLVQWLKVKKSEH
REPKLNEKLHGRGAGFHGAGMFRPPLPAPSPPPPRAVQPQCPSR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggggacctggacatcgggctgctggacttcctgctgttcggcagcctgattgccgct
gtggacccggtggccgtgctggccgtgttcgaggaggtgcacgtcaacgaggtgctgttc
atcatcgtcttcggggagtccctgctcaacgacgccgtcacagtggtcctgtacactgtg
tttgaatctttcatcgcgctgggtggggacgaggtgaccggcgtggactgcgtgaaaggc
atagtgtccttcttcgtggtgagcctggggggcacgctggtgggggtgctgttcgccttc
ctgctgtctctggtgacgcgcttcaccaagcacgtgcgcatcatcgagcccggcttcgtg
ttcgtgatctcctacctgtcctacctcacctccgagatgctgtccctgtcctccatcctg
gccatcaccttctgcggcatctgctgccagaagtacgtgaaggccaacatctcggagcag
tcggccaccaccgtgcgctacaccatgaagatgctggccagcggcgccgagaccatcatc
ttcatgttcctgggcatctcggccgtggacccgctcatctggaagtggaacacggccttc
gtgctgctcacgctggtcttcatctccgtgtaccgggccatcggcgtcgtcctgcagacc
tgggtcctgaaccggtaccgcatggtgcagctggaggtcatcgaccaggtggtcatgtcc
tacggcggcctgcgcggggctgtggctttcgcgctggtcgtcctcctggacgagagcaag
gtcaaggagaagaacctcttagtcagcaccaccatcatcgtcatctacttcaccttccag
cttggcggcctgaccatcaagcccctggtgcagtggctgaaggtgaagaagagtgagcat
cgagagcccaagctcaacgagaaactgcatggcaggggagctggattccacggagccgga
atgttccgtcccccgctgcctgccccctccccgccgccaccccgagccgtccagccacag
tgcccctccaggtga

DBGET integrated database retrieval system