KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499954
Entry
107499954         CDS       T06036                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107499954 (AHRR)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107499954 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4
Other DBs
NCBI-GeneID: 107499954
NCBI-ProteinID: XP_015980143
Position
Unknown
AA seq 691 aa
MLPPGECTYAGRKRRKPVQKQKPATGAEKSNPSKRHRDRLNAELDHLASLLPFPADVVAK
LDKLSVLRLSVSYLRVKSFFQALQEQRPGPPATRTPSPGGSGPRRPPAVLEGRMLLETLD
GFALVVSADGVIFYASATIADHLGFHQTDVMHQNVYDYIHVDDRQHFRRQLHWAMDPPQA
ACGQPLSSRAGEDAVLGRLLRAQDGAAGPTEFAAFLRRCFTCRVRCLLDSTSGFLTMQFQ
GKLRFLFGQKRKAPSGTGLSPRLSLFCIVVPVLPSVAEMKTKGAFPFPRAKHRPDAAPVT
DAKAKATRSLCESELHGKPSFLAGRSNGEHGASVFRAQVDACCWARAPARATCLCLRGGP
DLVLGPEGAARDRGAGEHGRARRDMHTYDCRFQTPGPGRHLSWGTGKRGQDGARLKLEPS
RGEPFPTHAAARGSCLSSPGGPGTVPAFRNPPSCHQAPGAFPSRASRGLRDGGQGQARPS
ASCPFPQGGLENRLPQSSVQRLAVGGYSTEDIKVRGVPMPSGAPCNPMLSSLNVPIKMES
DSGSENAPDGYCMPPSQMWLGASDVAKRQLVTFPTRMHLKTEPDSRPHLYSPHLGPGMLG
APPRPGRELALGHPSPCICLEPPPCLCVRGHQPPTLGCDCRAPAPTPVVKREPLDSAPWA
AHSQGGVHRVLPKGALAALVPPTASEGAFRP
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgctcccgccgggcgagtgcacgtacgccggacgcaaaaggaggaagcccgtccagaaa
cagaagcccgccacgggggccgagaagtcgaacccctccaagcggcaccgagaccggctc
aacgccgagctggaccacctggccagcctgctgcccttccccgccgacgtggtcgccaag
ctggacaagctctcggtgctgcgtctcagcgtcagctacctccgcgtgaagagcttcttc
caagccctgcaggagcagcgcccggggccgccagccacccgcacgccctcgccggggggc
agcggccctcgcagacccccggccgtgctggagggacgaatgctgctggagaccctggac
ggcttcgccctggtcgtgagcgcggacggggtcatcttctacgcctcggccaccatcgca
gaccacctgggcttccaccagacggacgtgatgcaccagaacgtgtacgactacatccac
gtggacgaccgccagcacttccgccggcagctgcactgggccatggacccgccgcaggcc
gcgtgcgggcagcctctgtcctcgcgggcaggcgaggacgccgtcctggggaggctgctc
agggcccaggacggggccgccggccccaccgagttcgcggccttcctgaggcgctgcttc
acctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagtttcaa
ggaaaattaagattcctgtttggacagaagaggaaggcgccgtcaggaacgggcctgtcc
ccccggctctcactgttctgcattgtggtgccggtcctgccgtccgtggcggagatgaag
accaagggcgcgtttccgtttccgcgggcgaagcacaggccagacgctgcacctgtgacg
gacgcaaaagcgaaagctaccaggagtctgtgtgagtccgagttgcacggaaaacccagt
ttcttagcaggaaggagcaatggagagcatggcgcctcggtgttccgggcacaagtggat
gcctgctgctgggcccgggctccagccagggccacgtgcctgtgcctgcggggtggcccc
gacctcgtccttggccctgagggggccgcaagggacaggggtgcaggggagcatggcagg
gcacggagagacatgcacacgtacgactgccgcttccagacgccaggacctgggaggcac
ctgagctgggggacagggaagcgcggccaggacggggccaggctgaagctggagcccagc
aggggtgagccgttccccacacatgccgcagcccggggctcctgcctgtcctcccccggt
ggcccaggcaccgtccctgccttcaggaacccccccagctgtcaccaggcccccggtgcc
ttccccagccgggccagcagaggcttgcgggatggaggtcagggccaggcgcgcccttcc
gccagctgccccttcccgcaggggggcctggagaaccggctgcctcagtcctctgtgcag
cggctcgcagtaggaggctattccactgaggacatcaaggtgcgaggtgtgcccatgccc
tcaggagccccatgcaaccccatgttgtcctcactcaatgtgcccatcaagatggagagt
gactccgggtctgagaatgcaccagatggctactgtatgcctccaagccagatgtggctg
ggagccagtgacgtggccaagagacagctggtcactttccctactaggatgcacctgaaa
acagagccagactccaggccccacctgtacagcccgcacctggggcccggcatgctaggg
gcaccccccaggccaggcagggagctcgccctgggccacccctcgccctgcatctgcctg
gagcctcctccctgcctctgtgtgcggggccaccagcccccaactctgggctgtgactgc
agagctcctgcgcccacacccgtggtcaagcgcgagccgctggactcagccccgtgggct
gctcacagtcagggcggggtgcacagggtgcttcccaaaggtgccttggcagcactggtg
ccgcccaccgcctctgagggcgctttccggccatag

DBGET integrated database retrieval system