KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504025
Entry
107504025         CDS       T06036                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray00240  Pyrimidine metabolism
ray01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107504025 (DCK)
   00240 Pyrimidine metabolism
    107504025 (DCK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107504025 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33
Other DBs
NCBI-GeneID: 107504025
NCBI-ProteinID: XP_015988432
Position
Unknown
AA seq 260 aa
MATPPKRSCLSPVTSSEGTHIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPIARWCN
VQSVQDEFQELTTSQKSGGNVLQMMYEKPERWSYTFQSYACLSRIRSQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWLNNQFGQSLELDGIIYLRA
TPEKCLSRIYLRGRNEEQGIPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLVERVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggctaccccaccgaagaggagctgcctatctcctgtgaccagctctgaggggactcac
atcaagaaaatttccatcgaagggaacatcgctgcagggaagtcaacgtttgtgaatatc
cttaaacaagtctgcgaggattgggaagttgttcctgaacctattgccagatggtgcaat
gttcaaagtgttcaagatgaatttcaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttataccttccagtcatatgcc
tgcctcagccgaatacgatctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatccaac
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggttgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgagtagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagaaaagcttcactctaagcatgaaagctggctcctgcatagaaca
ctgaaaaccaactttgattatctacaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagataaacacgacagtctggttgaaagggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system