KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504952Help
Entry
107504952         CDS       T06036                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107504952 (OXTR)
   04024 cAMP signaling pathway
    107504952 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107504952 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107504952 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107504952 (OXTR)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Oxytocin
    107504952 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 107504952
NCBI-ProteinID: XP_015990102
Position
Unknown
AA seq 388 aa AA seqDB search
MEGALLANWSVEAVNASTPPLGVEGNRTTGPPQRNEALARVEVAVLCLIFFLALSGNVCV
LFALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICHPLRALHHRADRLAVLATWLGCLVASVPQVHIFSLREV
AEGVFDCWAEFIQPWGPKAYVTWITLSVYVVPVIVLAACYGLISFKIWQNFRLKTAAAVA
EGPERAAASGGERAALARVSNVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
TNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFQELMQRFLCCSSSYPRGSRPGETS
VSKKSNSSTFVLSRHSSSQRSCSQPSSL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcgcttttggccaactggagcgtggaggcggtcaatgcgagcacgccaccg
ctgggggtcgagggcaaccgcaccactgggcctccgcagcgcaacgaggccctggcgcgc
gtggaggtggcggtgctgtgcctcattttctttctggcgctgagcggcaacgtgtgcgtg
ctgtttgcgctgcgcaccacgcgccacaagcactcgcgccttttcttcttcatgaagcac
ctaagcatcgccgacctggtggtggccgtgttccaggtgttgccgcaactgctgtgggac
atcaccttccgcttctatgggcccgacctgctgtgccgcctggtcaagtatctgcaggtg
gtgggcatgttcgcttccacctatctgctgctgctcatgtcgctcgaccgctgcctggcc
atctgccatccgctgcgcgccctgcaccaccgcgctgaccgcctggctgtacttgctacg
tggctgggctgcctagtggctagcgtgccgcaggtgcacatcttctcgctgcgcgaggtg
gccgagggcgtcttcgactgctgggcggagtttattcagccgtggggccccaaggcttat
gttacgtggatcacgctctccgtctacgttgtaccggtcatcgtgcttgccgcctgctac
ggcctcatcagcttcaagatctggcaaaactttcggctcaagacggcagctgcagtggcc
gaggggccggagcgcgcagcggcgagcggcggggaacgcgcggccctagcacgcgtcagc
aacgtcaagctcatctccaaggccaagatccgcacggtcaagatgacgttcatcatcgtg
ctagccttcattgtgtgctggacgccattcttcttcgtgcagatgtggagcgtctgggac
accaatgcacccaaggaagcctcggctttcatcatcgccatgctcctggccagcctcaac
agctgctgcaacccctggatctacatgctcttcacaggccacctcttccaggagctcatg
cagcgcttcctctgctgctcctccagctacccgaggggctcccggccaggagagacgagt
gtcagcaaaaagagcaactcgtccacctttgtcctgagccggcacagctccagccagagg
agctgctcacagccatcctccctgtga

DBGET integrated database retrieval system