KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508277Help
Entry
107508277         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00270  Cysteine and methionine metabolism
ray00280  Valine, leucine and isoleucine degradation
ray00350  Tyrosine metabolism
ray00360  Phenylalanine metabolism
ray00380  Tryptophan metabolism
ray00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ray01100  Metabolic pathways
Module
ray_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107508277
   00270 Cysteine and methionine metabolism
    107508277
   00280 Valine, leucine and isoleucine degradation
    107508277
   00350 Tyrosine metabolism
    107508277
   00360 Phenylalanine metabolism
    107508277
   00380 Tryptophan metabolism
    107508277
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107508277
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     107508277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox Pyr_redox_2 HI0933_like Phage_tail_X FMO-like FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 107508277
NCBI-ProteinID: XP_015995448
Position
Unknown
AA seq 556 aa AA seqDB search
MRPATAGVELDPHKKRESHSGFNMCCRSIVKMRGILILGLLLATPSCLGCYGDLVKCFQD
PEYESILVTAQEGRHTSPLSKRMVVVGTSTSGLVVAKTLQDAGSQITVLEASDHIGGRVV
TFRNKDEGLYYEPGPKRIPKSHRLVHTYVRKLDLKLNKFIQYDGNTWYLINGQHYHTREV
KANPELLGYFVNPTEKSKSAETLSHQSTANLKQSLNNFNCSHLMSFYDSYSTKAYLLKEG
TLSPGAVKMIRDVKNEDVECYKSFLASLWSDIIFPKSDEDHGGLDQLPRALGASLKPGTI
LRGSKVKMVVRDGPEVQISYRVGEPHSVLHPLTTDFVIVSTSAKATRLIIFKPPLSLDKV
DALCWVHYXSATKVVLACNEPFWEQDGIWGGVSITHRPSRYIYYPSHSLPSSKGIPLASY
TLDDDSLFFISMRQDQVVDIVLEDLSVLHWVPKEAPRCMRPSSVIKYCSLDPLVLGAFSK
FTPYQFENYLQHFFQPEGLIHFAGEHTCLPHAWIDTAIKSSLWAARNIPAAVDEEAKKGS
QPLPTPRLVSHAERNP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagctactgctggggtggagctggatcctcataaaaagagggagagccactca
gggttcaacatgtgctgcaggtccatagtcaagatgaggggaatcctgatcttggggctc
ttattggctactcccagctgtcttggctgctatggggacctggtcaagtgcttccaggac
cctgaatatgagtccatccttgtcacggcccaggagggccgccacacctccccactgtcc
aagcgcatggtggtagtgggaactagcacgtcaggcctggtggtggccaagaccctgcag
gatgccggatcccagattacagtcctagaagccagtgaccacattgggggtcgagtggtc
acattcaggaataaggatgaaggcctgtactatgaaccgggacccaagcgaatcccaaag
tcacataggctggtccacacctatgtcaggaagctggatctgaagctaaacaagttcata
caatatgatggcaacacctggtacctcatcaatggacaacactatcacactagggaggtc
aaggccaacccagagctcctgggctattttgtgaaccccacagagaagagcaaaagcgct
gagactctctcccaccagtccactgccaacctcaaacaaagtctgaacaatttcaactgc
agccacctgatgtccttttatgattcatactccaccaaggcttacctgctgaaggaagga
acgctgagcccgggagcagtaaagatgatcagggatgtgaagaatgaagatgttgaatgc
tataagtcatttcttgcatctctatggtcagacatcatctttcccaaaagtgatgaagat
catggtggcttggaccagctccccagagcccttggcgccagcttgaagcctggcaccatc
ctccgaggctccaaggtgaagatggtagtgagggatgggcctgaggtccagatttcctat
cgggtgggtgagccccactcggtgctgcaccccctcaccacggactttgtcatcgtctcc
acctcagcgaaggccacgcgcctcatcatctttaagccaccactctccctagacaaggtg
gacgcgctttgctgggtgcactacnncagtgctaccaaggtggttctggcctgtaatgag
cccttttgggagcaggatggaatctggggcggggtctccatcacccaccggccctcgcgc
tacatctactaccccagccacagcctccccagcagcaagggtatcccgctggcctcctac
accttggatgatgattctctcttcttcatatccatgaggcaggaccaggtggtggatatc
gtcctggaggacctgtcggtccttcactgggtgcctaaggaggcgccgcggtgcatgcgc
ccttcctctgtgatcaaatactgctctctggacccgctggtcctgggtgccttctccaag
ttcacaccctaccaatttgagaactatttgcagcacttcttccagccagagggcctcatc
cactttgctggcgagcacacctgcctgccccatgcctggatagatactgccatcaagtcc
agcctctgggcagccaggaacatcccagctgccgtggacgaggaagccaagaaaggcagc
caacctttaccaacacccaggcttgtttctcatgctgagagaaatccctga

DBGET integrated database retrieval system