KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508881Help
Entry
107508881         CDS       T06036                                 

Gene name
ALDH5A1
Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00650  Butanoate metabolism
ray01100  Metabolic pathways
Module
ray_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107508881 (ALDH5A1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107508881 (ALDH5A1)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     107508881 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107508881
NCBI-ProteinID: XP_015996389
Position
Unknown
AA seq 529 aa AA seqDB search
MATCSWLRSCGSLRYPLVRPRRRLLPRPGCWASGRAPLRTYAPGPGSLPAALLRTDSFVG
GRWLPAAAVFPVLDPASGAELGRVADCGATEARGAVDAAYKAFCSWRGVSAKERSSLLRK
WYDLMIQNKDDLAKIITAESGKPLKESQGEILYSAFFLEWFSEEARRVYGDVICTPAKEK
RALVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELANQ
AGIPPGVYNVIPCSQRKAKDVGEALCTHPLVSKISFTGSTATGKILLHHAADSVKRVSME
LGGHAPFIVFDSANVDQAVAGAMASKFRNSGQTCVCSNRFLVQRGIHDSFVKKFAEAIKT
NLHVGNGFEERTTQGPLINEKAVEKVEKHVSDALSKGATVVTGGKRHQLGKNFFEPTLLS
NITQDMLCSHEETFGPLAPVIKFDTEEEAVAIANATNVGLAGYFYSQDPAQIWRVAEQLE
VGMVGVNEGLISSVECPFGGMKQSGLGREGSKYGIDEYLELKYVCFGGL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgctcttggctgcggagctgcggctccctgcgctaccctctggtgcgtccc
cgccgccgtctcctcccgcggccgggctgctgggcgtctggacgggccccgctccgcacc
tacgccccgggcccaggcagcctgcccgccgcgctgctgcgcaccgacagcttcgtgggc
ggccgctggctccccgccgccgccgtcttccccgtgctggacccggccagcggcgccgag
ctgggccgtgtggctgactgcggggcaacagaggcccgcggcgccgtggacgcggcctac
aaggctttctgcagctggaggggcgtctccgccaaggaaaggagttcattacttcggaaa
tggtatgatctaatgattcaaaataaggatgaccttgccaagataattacagctgaaagt
ggaaagccgctgaaggaatcacagggagaaattctgtattctgcctttttcctggagtgg
ttttcagaggaagcccgccgtgtttatggagacgttatctgtacccccgcaaaggaaaag
cgggccctggtcctcaagcagccggttggtgtggccgctgtcatcactccgtggaatttt
cctagcgccatgatcacccgcaaggtgggggctgccctggcagctggctgcacggttgtg
gtgaaacctgctgaagacacacccttctcagccctggccctggctgagctcgcaaatcag
gctggaattcctccaggggtatacaatgtcattccctgctcccagagaaaagccaaggat
gtaggggaggcgctttgcactcatcctcttgtatccaaaatttccttcactggctcaaca
gctactggaaagatactgttgcaccatgcggccgactctgtgaaaagagtctccatggag
ctgggtggccacgccccattcattgtatttgatagtgccaatgtggaccaggctgtggca
ggggccatggcatctaaatttaggaactctggacagacttgtgtttgctcaaaccgtttc
ttggtgcaaaggggtatccatgattcctttgtgaaaaaatttgctgaggcaattaaaaca
aacctgcatgtgggtaacggatttgaggagagaactactcaaggcccattaattaatgaa
aaagcagtagaaaaggtcgagaaacacgtgagtgacgcactttccaaaggggccactgtt
gtgacaggcgggaagcggcatcaacttggaaaaaatttcttcgagcctaccctgctcagc
aatatcacccaggacatgctctgctctcatgaggagacttttgggcctctggcaccagtc
atcaagttcgacacagaggaggaggctgtggcaatcgctaatgcaaccaatgttgggtta
gcaggttatttttattctcaagacccggcccagatctggcgggtggcggaacagctggaa
gtcggcatggtgggcgtaaacgaagggctcatctcctccgtggagtgccccttcggcggg
atgaagcagtctggccttgggcgagagggctccaagtatggcattgatgagtatctggag
ctcaagtatgtgtgttttggaggcttatag

DBGET integrated database retrieval system