KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509322
Entry
107509322         CDS       T06036                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107509322 (AKAP5)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     107509322 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 107509322
NCBI-ProteinID: XP_015997241
Position
Unknown
AA seq 425 aa
METTVSEIQVESKDEKRSAEVSPQDERQEEKASMLCFKRRKKSAKATKPKAGSEAANVTR
TCPPEAGASDQPQPPGRAWASFKCLVPRRKRSDSSKQQKPFEAKVQTEINTEDADLPKKK
AKSRLKIPCIKFSKGEKRHNHSKITEDADCSVKVQGEAERLDTKTTTQSDDQTTKTKSTQ
DVSGGVSQKGDDEVCESNVSNSITSPGEKVITVEFGLDPEHSAIQTGTLILEKGIENIEE
KQSVQPQQASPLETSETEHQLPVVSDAPPSPAVSDQQIVEEARNSILESETNWKDHESGE
TVGEESKAKDNELSQESDFKEIEISAEKPIPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQANDSGFEGRTSDQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKI
NNLLQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaagcaaagatgagaagagatcagcagaa
gtcagtcctcaggatgagaggcaggaggaaaaagcatcaatgctttgcttcaagagaaga
aagaaatcagccaaagcaacgaagcccaaagctggctctgaagctgctaacgtgacaagg
acatgtccacccgaagcaggagcttctgatcagccacagcccccagggcgggcctgggcc
tccttcaaatgccttgtacctcgcagaaaaagatcagattcttcaaagcagcaaaagccc
tttgaggctaaagtacaaactgaaatcaatactgaggatgctgatcttcctaaaaaaaag
gcaaaatccagacttaagattccctgcataaaattctcaaagggggagaaaagacataat
cattccaaaattacagaagatgcagactgcagtgtcaaagttcagggagaggctgaaagg
ttggatacaaaaactacgacccaatcggatgaccaaacaacaaagaccaagtcgacccag
gatgtaagtggaggtgtctcacagaaaggggatgatgaggtctgtgaatcaaatgtgagc
aacagtataacttctcctggagagaaagtgattacagtagaatttgggttagatccagaa
cattctgctattcaaacaggaactctaatccttgaaaaaggtattgaaaacattgaggaa
aaacaaagtgtccaaccccagcaagcaagcccacttgaaacttcagaaacagaacatcag
ctaccagtggtttccgatgctcctccttcacctgcagtctcagatcaacaaattgtggaa
gaagccagaaacagtatcctagaaagtgaaacaaattggaaagaccatgaaagtggagag
actgtaggtgaggagagtaaggcaaaagataatgaattgagccaggaatcagattttaaa
gaaattgagatcagtgcagagaaacccataccagaagaaagcaaaagaatggagccaatt
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatttcaattgaaaatgagcaagctaatgatagtggttttgagggt
agaacttcagaccaatatgaaacacttttaatagaaacagcttcttctcttgtcaagaat
gctatccagttgtctatagaacagctagttaatgaaatggcctctgatgataataaaata
aacaatcttctacagtga

DBGET integrated database retrieval system