KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510924Help
Entry
107510924         CDS       T06036                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510924 (PLA2G4F)
   00565 Ether lipid metabolism
    107510924 (PLA2G4F)
   00590 Arachidonic acid metabolism
    107510924 (PLA2G4F)
   00591 Linoleic acid metabolism
    107510924 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    107510924 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107510924 (PLA2G4F)
   04010 MAPK signaling pathway
    107510924 (PLA2G4F)
   04370 VEGF signaling pathway
    107510924 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    107510924 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510924 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510924 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    107510924 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    107510924 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510924 (PLA2G4F)
   04913 Ovarian steroidogenesis
    107510924 (PLA2G4F)
   04921 Oxytocin signaling pathway
    107510924 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510924 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510924 (PLA2G4F)
   04726 Serotonergic synapse
    107510924 (PLA2G4F)
   04730 Long-term depression
    107510924 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510924 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510924 (PLA2G4F)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510924 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 107510924
NCBI-ProteinID: XP_016000382
Position
Unknown
AA seq 849 aa AA seqDB search
MLWALWPRWLAGKGLPLLGVMLLRKRDKRGSQWSHWQRETHPYYDLQVKVLRARNIQGTD
LLSKADCYVQLWLPTASPSRAQTRMVANCSDPEWNETFHYQIHAAVKNVLELTLCDKDIL
GSKKLSVLLFDLESLKPGQPHRHTFPLNQQDSQELQVEFVLENSQVPASEVITNGVLVAH
PCLRIQGTLGGDATAPHQEYGSRQIRLVVPGAYEKPQLLPLQPPLEAEPPATFTFHVNPV
LHSRLDVELGENLMVLQSDPSAELEAQSSKLGEGGILLSSLALGQEEQRLVALGEGQEVT
LNVKAEMSSGDLDLRLGFDLCDGEQKFLDKRKQIVSKALQQVLKLNQAPDSDQVPVVAVL
GSGGGTRAMSSLYGSLTGLQELGLLDTVTYLKGVSGSTWCISTLYKDPAWSQVALQGPTE
LARGRVCSSKIGAVSTERLQYYAQELGKLESSGHSISLIDLWGLLIEYFLYQEENPAKLS
DQQEAISQGQNPYPIYASINVRTNISGEDFAEWCEFTPHEIGFPKYGAYIPTKLFGSEFF
MGRLLKLWPEPRICYLQGMWGSAFAASLDEIFMKTAGFSLSFLDLHRGHVNITDDCQKLQ
LHDPTRLRTKLFTRQGPFSQAVLDIFTSRFTAAENFNFTQGLCLHKDYVAGREFTAWKDT
HLDALPNELTPMRDCLYLVDGGFALNSPFPLSLLPQRAVDLIVSFDYSLDAPFEVLQMTE
KYCRDRGIPFPRVEVLPEDLEEPRECYLFDRAEDPCSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAHGDFAINGPDTPYGMTNFTYEPEEFDRLVALSRYNVLNNAETVRRALRLALDR
RQAGARAGG
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcgttgtggcctaggtggctggcaggcaaggggctacccctcctgggggta
atgctgctgcggaagagagacaaaaggggatctcagtggagtcactggcagcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccagggcacagat
ctgttgtccaaagctgactgctatgtgcaactgtggctgcccacggcatcccccagccgt
gcccagacaaggatggtggccaactgcagtgaccccgagtggaacgagactttccactac
cagatacatgctgctgtgaagaatgtcctggagctcaccctctgtgacaaggacatcctg
ggtagcaagaagctctctgtgctgctgtttgacctggagagcctcaagcctggccaaccc
cacagacacactttcccactcaaccaacaggattcacaagagctgcaggtggagtttgtt
ctggagaacagccaagtacctgcatctgaagtcatcaccaatggtgtcctggtggctcat
ccctgtctgagaatccagggcacccttgggggagatgcaacagcccctcatcaagaatat
ggttctaggcagattcggttggtagtgcccggggcctacgagaaaccacagctcttgcct
ctgcagcctcccttggaggcagaacccccagccacttttaccttccatgtgaatccagtg
ctacactccaggctggatgtcgagctgggagagaatctcatggtcctgcagagtgaccca
agtgctgagttggaggcccagagcagcaagctgggagaggggggcatcctgctctcttct
ctggccttaggccaggaggagcagcgcttggtggccctgggggagggccaggaggtaact
ctgaatgtgaaggcagaaatgagctctggagaccttgacctgcgccttggctttgacctc
tgtgatggagaacagaagtttctggacaagaggaagcagatcgtgtctaaggctttgcag
caggtgctgaaactgaaccaggctcctgacagtgaccaggtacctgtggtggctgtgctg
ggttcgggaggcggaacccgtgctatgtcttccctgtatggcagcctgacagggctgcag
gagcttggcctcttggacactgtgacctacttgaaaggggtttctgggtccacctggtgc
atctccacactctacaaagacccagcctggtcccaggtggctttgcagggccccactgag
cttgcccggggtcgggtctgcagcagtaagataggggcggtatccacggaacgtctacaa
tactatgcccaggaactggggaaactggaaagcagtggtcacagcatttccctcatcgac
ctctggggcctcctcattgaatatttcctataccaagaggaaaaccctgccaaactgtct
gaccaacaggaggcaatcagccagggccagaacccttatcccatctatgccagcatcaat
gtccgtaccaacatcagtggggaagactttgcagagtggtgtgagttcaccccccacgag
atcggcttccccaagtatggggcttatattcccaccaagctctttggctcagagttcttc
atggggcgactgctgaagctctggccagagccccggatctgctacttgcagggtatgtgg
ggcagtgcctttgcagccagcctggatgagattttcatgaagactgctggcttcagcctc
agcttcctggacttgcaccgaggccatgtaaacatcacagatgactgccagaagctccag
ttgcatgaccccaccaggctgcgaacaaagctcttcactcggcaggggcccttctcccag
gctgtgctggacatattcacgtcccgctttaccgccgcggagaacttcaacttcacccag
ggcctctgcctgcacaaggactatgtggctggcagggagttcacggcctggaaagacact
cacctggacgccttgcccaatgagctcactcctatgagggactgcctgtacctggtggac
gggggctttgctctcaactccccattcccactgagcctgctgccgcagagagcagtggac
ctcattgtgtcctttgactactccctggatgccccttttgaggtcttacagatgacagag
aagtactgccgggaccgaggcatcccctttcccagggtcgaggtgctccctgaggacctg
gaggaaccccgtgagtgctacctgtttgacagagctgaggacccttgctcacccatcgtg
ctgcacttccctcttgtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagccgaggagaaggcccatggagactttgccatcaacgggccagacacgccctat
ggcatgacgaacttcacctatgagcccgaggagttcgatcggctggtggccctgagtcga
tacaacgttctgaacaacgcggagactgtgaggcgtgccctccggctggctctggaccgg
cggcaggctggagccagggctggaggctga

DBGET integrated database retrieval system