KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511586Help
Entry
107511586         CDS       T06036                                 

Gene name
DNASE2B
Definition
(RefSeq) deoxyribonuclease-2-beta isoform X1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107511586 (DNASE2B)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     107511586 (DNASE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 107511586
NCBI-ProteinID: XP_016001565
Position
Unknown
AA seq 356 aa AA seqDB search
MTARFQRTTLAFLFLGLFGVLEATISCRNEEGKAVDWFAFYKLPKRQDKESRKTGLEYLY
LDSTTRSWRRSKQLMNTTKSVLGRTLQQLYEVYTSKNNNTAYLIYNDGVPKSVNYSRKYG
HTKGILLWNKVQGFWLIHSIPQFPPVPEEGYDYPPTGRRNGQTGICVTFKYNQYEAIDSQ
LLVCNPKIYSCSIPSTFLQELVHMPKLCASSNLSEIPGRHLVTLQSAQGQNFLHFAKSDS
FLDDIFAAWMAQRLKTHLLAETWQRKRQELPSNCSLPYHVYNIKAIKISGHSYFSSYQDH
AKWCISQKGTKNRWTCIGDLNRSPYQAFRSGGFICTQNQRIYQAFQELVLYYENCS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagatttcaaagaacaacccttgctttccttttccttggcctctttggggtc
ctggaggcgacaatatcttgcagaaatgaagaaggcaaagctgtggattggtttgccttt
tataagttacctaaaaggcaagacaaggaaagtagaaagactgggttagagtatctatac
ctagactctacaaccagaagctggaggaggagtaagcaattaatgaataccaccaagagt
gttttgggaaggaccttacaacagctgtatgaagtatatacctccaagaataacaacact
gcttacctaatatacaatgacggagtccctaaatccgtgaattacagcagaaagtatgga
cacaccaaagggatactgctgtggaacaaagtccaggggttctggctgattcattctatt
ccccagtttcctccagttcctgaagaaggctatgattatccacccacagggagacgaaat
ggacaaactggcatctgcgtaactttcaagtacaaccagtatgaagcaatagattctcaa
ctcttggtctgcaacccaaagatttatagctgttccatcccgtctacctttctccaggag
ctcgttcacatgcccaagctctgtgccagctccaacttatcagagatccctggccggcac
ctcgtcacacttcagtcagcccagggacaaaactttctccattttgcaaaatccgattct
tttcttgatgacatttttgcagcctggatggctcaacgattgaagacgcacttgctagca
gaaacctggcagcgtaagagacaagagcttccttcaaactgctcccttccttaccatgtc
tacaatatcaaagcaattaaaatatctggacattcctatttcagttcttatcaggatcat
gccaaatggtgtatttcacaaaaaggcactaaaaatcgctggacatgtattggagaccta
aatcggagcccataccaagctttcagaagtggaggattcatttgtacccagaatcagcgt
atttaccaagcgtttcaagaattagttttgtattatgagaactgtagctaa

DBGET integrated database retrieval system