KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514263
Entry
107514263         CDS       T06036                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107514263 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107514263 (ASIC1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107514263 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 107514263
NCBI-ProteinID: XP_016007305
Position
Unknown
AA seq 547 aa
MHTYSLRVVRTRDVRRIPLARMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERL
SLKRALWALCFLGSLALLLCVCTERVQYYFNYHHVTKLDEVAASQLTFPAVTLCNLNEFR
FSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYD
RAGHDIRDMLLSCQFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLE
IMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQR
LIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQ
YKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYI
GENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVI
KHKLCRRGKCQKDAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARG
TFEDFTC
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcacacatacagcctgcgggtagtgagaactagagacgtccgcaggattcccttggcc
aggatggaactgaaggctgaggaggaggaggtgggtggcgtccagccggtgagcatccag
gccttcgctagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctg
tcactgaaacgggcgctctgggccctgtgcttcctgggctcactggctttgctgctgtgt
gtgtgcacagagcgtgtgcagtactacttcaactaccaccacgtcaccaagctcgacgag
gtggctgcctcccagcttaccttccccgccgtcacgctgtgcaacctcaatgagttccgt
tttagccaagtctccaagaatgacttgtaccatgctggagaactgctggccctgctcaac
aacaggtatgagatacccgatacacagatggcagatgaaaagcagctggagatactgcag
gacaaggccaacttccgcagtttcaagcccaagcccttcaacatgcgcgagttctacgac
cgcgcagggcacgacattagagacatgctgctctcctgccaattccggggggaggtctgc
agcgcagaagacttcaaggtggtctttacacggtatggaaagtgctacacgttcaactcg
ggccgagatgggcgtccacggctgaagaccatgaagggtgggacgggcaatgggctggag
atcatgctagacatccagcaggacgagtacctgcccgtatggggggagactgatgagacg
tccttcgaagcaggcatcaaagtgcagatccacagtcaggatgaacctcccttcatcgac
cagctgggctttggtgtggccccagggttccagacctttgtggcctgccaggagcagcgg
ctcatctacctgcctccgccctgggggacctgcaaagctgttaccatggactcggatttc
ttcgactcctacagcattactgcctgccgcattgactgtgagacccgttacctagtggaa
aactgtaattgccgcatggtgcacatgccaggagatgccccatactgcactccagagcag
tacaaggagtgtgcagatcctgctctggacttcctggtggagaaagaccaggagtactgt
gtgtgtgaaatgccctgcaatctgacccgctatggcaaggagctgtccatggtgaagatc
cccagcaaagcatcagccaagtacctggccaagaaattcaacaagtctgagcagtacata
ggggagaacatcctggtactggacattttctttgaagtcctcaactatgagaccattgag
cagaagaaggcttatgagattgcaggtctcctgggtgacattgggggccagatggggctg
ttcatcggggctagcatccttacggtgctggagctctttgactacgcctatgaggtcatt
aagcacaagctgtgcagaagaggaaagtgccagaaggacgccaaaaggagcagcgcagac
aagggtgtggccctcagcctggatgacgtcaaaagacacaacccgtgtgagagcctccgg
ggccatcctgccgggatgacgtatgctgccaacatcctacctcaccatccggcccgaggc
acttttgaggactttacctgctaa

DBGET integrated database retrieval system