KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514656Help
Entry
107514656         CDS       T06036                                 

Gene name
TTN
Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy (HCM)
ray05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    107514656 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    107514656 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107514656 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107514656 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107514656 (TTN)
   04147 Exosome [BR:ray04147]
    107514656 (TTN)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107514656 (TTN)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107514656 (TTN)
Membrane trafficking [BR:ray04131]
 Others
  Actin-binding proteins
   Others
    107514656 (TTN)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107514656 (TTN)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107514656 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Titin_Z Receptor_2B4 Pkinase fn3_4 Ig_6 Pkinase_Tyr Ig_5 PPAK Adeno_E3_CR1 THB Ig_4 Kelch_1
Motif
Other DBs
NCBI-GeneID: 107514656
NCBI-ProteinID: XP_016008048
Position
Unknown
AA seq 32327 aa AA seqDB search
MTTQAPTFKQPLQSVVVLEGSAATFEAHVSGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFAQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSITAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSTSPIRSVKSPLLTRKTQTAAMVSGPEVPPPWKQEGYVASSEAEM
RETTVTSATQIRTEERWEGRYGVQEQMTISGAAGAAASKSASATFAAGAVATGATEVKQE
TDKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTATHIQPAQEQMRKEAEKTAITTV
VVAADKAKEQELKSRTREVITTKQEQVHVTHEQIRKETEKAYVPKVVISTTKAKEQETRI
SGEVTTKQEQKQVTQETMRQEAETTAASMVVVATAKPTKQETIWGAQEEITIQDQMHITH
EKIMKETRKTVVPRVIVATPKVKEQDLVSRSREGITTKREQVQITQEKMRKEAEKTALST
IAVATAKAKEQETILRTREGMAARQEQVQVTHGKVDVGKKAEAVATVVAAVDQARVREPR
EPGHLEESYAQQATLEYGYKEHVSATKVVEHPQRPASEPQVVPKAVKPRVIQAPSETHIT
TTDQMGMHVSSQIQKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSA
IATLQKELSATSSAQKITKSVKAPTVKPAETRVRAEPTPSPQFPFTDTTETYRSQAGIEV
KKEVGVSITGSTVREERFEVLHGRETKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGE
SVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAV
NEAGTVSTSCYLAVQASEEFEKETTAATEKFTQEEKRFVESRDVVMTDTSITEERAEPGE
PAAPFFITKPVVQKLVEGGRIVFECQVGGNPKPHVYWKKSGVPLTSGYRYKVSYNKQTGE
CKLVISMTFADDAGEYTIVIRNKHGEISASASLLEEAEYDSLMKSQQEMLYQTQMTAFVQ
EPKVGEIAPGYIYSDYEKEYEKEQALIRKKMAKDTILVRTFVEDQEFHISSFEERLIKEI
EYRIIKTTLEELLEEDREERMAVDISESEAVEAGFDLRLKNYRILEGMGVTFHCKMSGYP
LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNFKGNAICSGK
LYVEPAAPLGAPTFIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPARMSPARMSPGRRL
EETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHDGQQVINDYTH
KVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGKSSISVILTVEAVEHQVKPLFVEKLK
NVNVKEGSRLEMKVRATGNPNPDIVWLKNSEIIVPHKYPKIRIEGTKGEAALKIDSTVSQ
DSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERRLIIPRGTYRAKEIAAPELEPLHLR
YGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGK
PLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEE
SQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCR
VTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEH
KVKLEIQQREDFRSVLRRAPEPKPEFHIHEAGKLQFEVQKVDRPVDTTEAKEIVKLKRAE
RITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTK
ELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVG
RPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSH
AFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEIHTGDKYRTH
SDRKVHFLSILTINMADADDYSCVLVEDENVKTTAKLIVEGAVIEFLKELQDIEVPESFS
GELECVVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVVDGK
KTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQPSDRVHI
VIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVEVITPLKDVNVIEGTKAV
LECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGRYKLLVGRVE
TSCNLSVEKIKIIRGLHDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAH
GKIYKLTVLNMMKDDEGEYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEV
ANPDSEGEWLKDGKHLPLSNDIRSEADGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLK
VEAVKIKKTLKNLTVTETQEAVFTVELTHPNVKGVQWIKNGVVLKPSDKYDISVKGTVYS
LRIKNCAIVDESVYGFKLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTV
PVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHIAPSDAGEYTAVVGQLECKAKLFVETLH
ITKTMKNIEVPETKSASFECEVSHFNIPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNT
STEDSAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFEVTVNHEGISYKWLK
NGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKH
IKDIKVLEKKRAVFECEVSEPDITVQWMKDGQELQIVDRITIQKEKYVHRLLIPSTRMSD
AGQYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDG
IEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQ
ELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSIGFKCKFLHDGQEYTLLLIEAFP
EDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGRPAR
FQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVANNAMG
QVSSTANLRLEAHESILHERIEQQIEVEMKEFSSCLLSAEEEGLQTYSSDLQLSNRNETL
ELLSEPPVHSTKFDSKKEGSVPIFIKEMSNAEISIGDVAKLSVTVTGIPKPKIQWFFNGV
MLTPSADYKFVFDSNDHSLIILFTKLEDEGEYTCIASNEYGQTICSAYLKINSKGQRHKE
TEPGSAVEKPLGNLEGPCPPYFLKELKPIHCTQGVPAIFEYMVIGEPAPTVLWFKENKQL
CTNVYYTIIHNPEGSGTFIVNDPQKEDSGLYVCKAENMWGESTCAAELLVLLEDTDMTDA
PCKAKSTPEAPKDFPQVLLKGPAIEAFDSEPGIAAFVKDTIWKAAPQAVLSDTEKISPGA
TSKEEISSLTVKPLKTLLAEPEGSYLQSLTEEPPAHSYPTSGVEEALLPKQKTVSSVDKE
QIGTLQKQEAQSALIMSQNLAEGHVESFKSPDIEVSNISYEPQVPSEHTCTEESEILMES
VYQLESTGLDLVARTEEGKSLSFPLACEEKQVLLKEKHSDNLVMPPNQTIECKKEPMAIQ
VVQEVRGSDNLSKESLLSGIPEEQRLNLKTQIRRALQAAVAIEQTSLFSEWLRNIKNVEV
KAINFSQEPKRIMCTYLITSGESLTEELTIAIEGIDPQMANLKTEFKDALCSIICEEINI
LTAEDPRIQKGTKTGLQEEIDSFSDSQTVEAITEPEIESKYLVSMEEVSHVNVESQVKVV
DTTTVPDGIATATLSDEKQDELPRPSEGSLIKEAGPIIHKPLADTVAEEGDIVNLTSSIT
NAKEVNWYFESKLVPSDEKFKCLQDQNTYTLVIDKVNTEEHQGEYTCEALNDNGKTETSA
KLTVVKRAAPVIKRRIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRS
SNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSITTFVGK
AAKFLCTVTGTPVIETIWQKDGAALSPSPNRKISDSENKHILELSNLTIQDRGVYSCKAS
NKFGADICQAELIIIDKPHFIKELEPVQSAINKKIHLECQVDEDRKVTITWNKDGQKLPP
GKDYKIYFEDKVASLEIPLAKLKDSGTYVCTASNEAGSSSSTATVTIREPATFIEKLEPS
QLLKKGDATQLACQVTGTPPIKITWFANDREIKESSKHKMSFVGSTAVLRLTDVAIEDSG
EYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFK
DNTTLRSGRKYKTFIQDQLVSLQILKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPTF
VKKIESTSSLRGGTAAFQASLKGSLPITVTWLKDNDEITEDNNIRMTFENNVASLYLSGI
EVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEI
TAKWFKDGQELTLGQKYKISVTDTVSILKIISTEKKDSGEYSFEVQNDVGRSSCKASINV
LEPPKFVKKLEASKIVKAGDSARLECKITGSPEIKVVWYRNEHELSASDKFRMTFIDSVA
VIQMNSLGTEDGGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPVVETLKNTEVSLECE
LSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIHILNLETSDIGEYHCKAQNEVGSDT
CICTVKLKEPPRFASKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRI
TFVENIATLQFAKAEPANAGKYICQIKNDGGMRENMATLTVLEPAVIVEKAGPMTVTVGE
TCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKQDAGTYTFQVQ
NNVGKSSCTAVVDVSDRMVPPSFTRRLKDTAGVLGTSCILECKVAGSSPISIAWFHEKTK
IVSGAKYQTTFSDNVCSLQLNFLDSSDMGNYTCVAANVAGSDECRAKLTVQEPPSFVKEP
EPLEVLPGKNVTFTSVIRGTPPFKVRWFRGARELVKGDRCNIYFEDTVAELELFNVDVSQ
SGEYTCVVSNGAGQTSCTTRLFVKGLLKCIFALPIFCTLTFLFVFLLCLTVVLCHSPEPA
TFVKKLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITPSEKCNIVTTEKTCILEIL
NSTKRDTGQYSCEIENEAGRDVCEALVSTLEPPYFVMELEPLEASVGDSVSLQCQVAGTP
EITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENNIGTASSKTVF
RIQGDIILEIQKFLFFLSSFIFMGDIFISSTSVSIITYLPTERQLPPSFARQLKDIEQTV
GLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCS
ASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDN
KEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVK
KLEASKVAKQGESIQLECKISGSPEIKVLWFRNDSELHESWKYNMSFINSVALLTINEAS
AEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFE
VVWVKDRKQVRSSKKFKMTSKNFDASLHILNLEASDIGEYHCKATNEVGSDTCTCIVKFK
EPPRFVKKLSDTSTLVGDAVELRAVVEGFQPISVVWLKDKGEVIRESESTRISFIDNIAT
LQLSSPEASNSGKYVCQIKNDAGMRECSAVLTVLEPARITEKPEPMTITTGNPFALECVV
AGTPELSTRWFKDGRELSADSKHHITFVNKVASLKIPCAEMSDKGLYSFEVKNSVGKSNC
TVSVHVSDRVVPPSFIRKLKDTNAVLGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQ
SSFSENVCTLNLNLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEILPG
MSLTFTSVIRGTPPFKVKWFKGSKELVPGESCTISLEDSITELELFEVEPLQSGDYSCLV
TNDAGSASCTTHLFVKGLLFFPICLSFKFFCLHLKMSILPSYFLLIEPATFVKRLADLSV
ESGSPIVLEATYTGTPPISVSWMKNEFPLSQSPNCSITMTEKSTILEILDSTVEDYAQYS
CLIENEAGQDICDALVSVLEPPYFIEPLEHVEAAIGEPTTLQCKVDGTPEIRISWYKEHT
KLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPTF
ARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQTSFVHNVATLQILRT
DQSHVGQYNCSASNPLGTASSSAKLILTEHEVPPFFDLKPVSVDLALGESGSFKCHVTGT
APIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAH
LGVQEPPRFIKKLEPSRIVKQDDYMRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLD
SVAVLEMYNLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPHPIETLKGTDIHL
ECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDTADIGEYHCKATNDVG
SDTCVGSITLKAPPRFVKKLSDISAIVGEEVQLQTAIEGAEPISVVWFKDKGEIVRESDN
IWISYSENIATLQFSRTETANAGKYTCQIKNDAGMQECFATLSILEPAAIVEKPESIKVT
TGDTCTLECTVTGTPELSTRWFKDGKELASDNKYKISFFNKVSGLKIINVAPSDSGVYSF
EVQNPVGKDSCTASVQVSDRIVPPSFTRKLKEANGLSGSSVVMECKVYGSPPISVSWFHE
GNEISSGRKYQTTLTDNTCALTVNMLEESDAGDYTCVATNVAGSDECSAPLTVREPPSFV
QKPDAMDVLTGTNVTFTSIIKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVD
TSQSGEYTCIVSNEAGKASCTTHLYVKAPAKFVKRLNDYSIEKGKALILEGAYIGTPPIS
VTWKKNGINITPSQKCNITTTEKSSILEIPSTVVEDAGQYNCYIENASGKDSCSAQILIL
EPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTSTCKMHFRNNVATL
VFNQVDSNDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFEC
AINGSEPISVSWYKDGKPLKDGPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSA
SSSAKLILTEGKNPPFFDIRIAPVDAVVGESADFECHVTGTQPIKVSWAKDGKEIRSGGN
YQISYLENSAHLTILKVDKGDSGQYTCYAVNEVGKDSCAAQLNIKERLIPPSFTKKLSET
VEETEGNSFKLEGRVAGSQPITVAWYKNNIEIHPTSNCEITFKNNALLLQVKKAGMGDAG
LYTCKLSNDAGSVLCTSSVVIKEPKKPPVFDRHLTPVTVSEGEFVQLSCHIQGSEPIRIQ
WLKAGREIKPSDRCSFSFANGTAVLELKDVAKADSGDYVCKASNVAGSDTSKSKVTIKDK
PAAAPAAKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPSVKWTKGKWRQLNQG
GRVFIHQKDDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLR
AMLKKTPALKRGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQE
EETHRLEIEEIEKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEID
IKINYPEIKLSWYKGTVKLEPSDKFEIRIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASA
KLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKV
HKLTIADVRAEDQGQYTCKYGDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVS
FDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARST
AELYLTTKEIKLEMKPPDIPDSRVPIPTMPIRAVPPEEIPSMVIPPIPLLLPSPEEKKPP
AKRIEVTKKAVKKDTKKVVTKPKEEAPPPKVPEVVKKPPPPTALIPAKAPEIIDVSSKAE
EVKITTITRKKEVQKEKEAVYEKKQAVYEEKKVYIEPLEEPYDELEVEPYTEPFEEPYYE
EPDEDYEETKVEARREVHEEWEEDFEEGQEYYEREEGYDEGEEEWEETYGEREVIQVQKE
IYEESHERKIPAKVPEKKKAPPPKVVKKPVVEKIEKTSRRMEEETVQVTKVPEVSKKIVP
QKPSRIPVQEEVVEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKKTVTEEKIH
VAVSKKIEPPPKVSEPPKKTVPEEMIPVPIPKKVEPPPAKVPEVPKKPVPEEKKPVPVPK
KEPAAPPKVPEVPKKPVPEEKMPVPIAKKKEVPPAEVPEVQKRVFTEEKITIITQREESP
PPAVPEIPKKKVPEEKRPIPRKKEEIPPPQVPALPKKPVPEEKVSVPVPVTKKAPPPRAE
VSKKTVVEEKRFVAEEKLSVAVPQRAEVTRHEVSTEEAWSYEEEEEERVSISVYREESRE
EEEEEVEVTEYEEMEEPEECVVEEMLHFISKRVEAEPAKVLEKHEKKIVPKPKIPAKIEE
RPPTKVSEAPKKTVLEKKILVALPKKEKMPPAEEEPKKPVPEKRALPKVTKIEELPAAKV
TERHMQITQEEKVHVAVTKKEEPPRARVPAEPKRAIPEEKVLKLKPKKEEVPPAQVTEFR
KRAVKEEKIAIEVPKREPRPTKELTVTEEKEWSYTREEETVSVQREEEYEEYEEYDYKEY
EEYEPTEEYDQYEDYEEREFEHYEEYKEQEEYITEPEKPVPVKPVQEEPVPTKPKAPTAK
VPEVPKKPEEKVPVPIPEKEKAPPARVPEVPKKPVQEEKIPVPVPKKVEAPPAKVPEVPK
KPVPEKKVPVPVPKKVEAPPAKVPEVPKKLIPEEKKPTPISKKVEVPPPKVPEVPKKVEE
RRIILPKEEEVPPVEVYEEPEEPLPEEEIAEEPPIREEVEEVAPPRVPEVMKEAIPEKKV
PVVPPKKPEVPPAKVPEVPKKPVLEEKPAIPVPKKVESPPPEAYEEPEEIAPEEEAPVPV
VEEEEPEAPPPAVPEEPKKIVPEKKVPIIKKPEAPPPKEPEPEKKVIEKPKFKPKPPAPS
PAPPKEDVKEKMFQLKAVPKKKVPEKPEVPEKVELTPLKVPGGEKKVRKLLPEPKPQPKE
EVVLKSVLRKRSEEEEPKVEPKKVEKIKKPAVPEPPPKAVEEVEAPPATVSKWEKKVPEP
AKVPEIKPAIPLPGPEPKVKPEPEVKTVKPPPVEPAPTPITAPVTVPVVGKKAEAKTPKE
EAAKPKGPIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDI
VLTEAESVGSSAIFECLVSPSTAITSWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSD
AGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVW
RKDGKIVTEKPGKIIPGVIGLMRALTINDADDYDAGTYTVTVENANNLECSSCVKVVEVI
RDWLVKPIRDQHVKPKGTAVFTCHIARDTPNIKWFKGYDEIPWEPNDKTEIVKEGNHVYL
KIKNAVPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVTIYEKESASFDAEISEED
IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAVTTAILTVKEI
ELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVIN
DSHFDDEGVYTAEVDGKKTSARLFVTGVRLKFISPLEDQTVKEGETATFVCELSHEKMHV
VWFKNDAKLHTSRTVLISSEGKTHKLEMREVTLDDISQIRAQVKDLSSTAHLKVLEADPY
FTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSLKHSIKSDGLHRVLKIKKAE
LKDKGEYVCDCGTDKTKANLNVEARLIKVEKPLYGVELFVGETARFEIELSEPDVHGEWK
LKGEPLTASPDCEIIEDGKKHTLVLYNCQLDMTGEVSFQAANAKSAANLKVKELPLIFIT
PLSDVKVFEKDEAKFECEVSREPKTYRWLKGTQEITGDDRFELIKDGTKHSMVIKSVAFE
DEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIPVKWFKN
DQRLHTSKVVSMHNEGKTHSITFKDLTLDDTSQIKVEAMELSSEAKLTVLEGDPYFTGKL
QDYTAVEKDEVILQCEISKPDAPVKWFKDGEEIKPSKNVIIKADGKKRMLILKKALKSDI
GQYTCDCGTDKTSGKLDIEDREIKMVRPLYSVEVMETETARFETEISEDDIHANWKLKGE
ALLQTPDCEIKEEGKVHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKD
VTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVTRSEGKVHTLTLRDVKLEDAGE
VRLTAKDFKTEANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEI
LKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ
VKEKEMARFECEISRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYS
CEVRTARTSGMLTVLEEEAVFTKNLNNIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIE
TGRYEILTDGRKRILIIQNAHLEDAGSYNCRLPSSRTDGKVKVHELAAEFISKPQNLEIL
EGEKAEFVCSISKESFEVQWKRDDKTLESGDKYDIISDGKKRILVVKDATLQDMGTYVVM
VGAARAAAHLTVIEKLKIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSK
YIILQKDLVYTLRIRDARLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIE
TMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRVSYRIDKYKHSLTIKDCGFPDEGEYI
VTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKE
GKKYKFEKDGSTHRLIIKDCRLDDECEYACGVEDRRSRARLFVEEIPVEIIRPPQDILEA
PGTDVVFWAELNKDKVEVQWLRNNMIIVQGDKHQMMSEGKIHRLQICDIRPRDQGEYRFI
AKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEALSSKT
VDTTAEQTSFRILEAQKGDKGRYKIVLQNKHGKAEAFINLQVIDVPGPVRNLEVTETFDG
EVGLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRV
SARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITN
YVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRVGVGKPSSATPFVK
VADPIERPSPPVNLNSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMK
LVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDTFVEPTMDLSAFKDGL
EIIVPNPIKILIPSTGYPRPTATWSFGDQVLEAGDRVKMKTLSAYAELVISPSERPDKGI
YTLYLENPVKAISGEINVNVIARPSAPKELKFDDITKDSVHLTWEPPDDDGGSPLTGYLV
EKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAP
ATVPDPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKGYLVEKCPRGSDRWVACGEPVAET
KMEVTGLEEGKWYSYRVKALNRQGASKPSKPTDEIQAVDTQEAPEIFLDVKLLAGLTVKA
GTKIELPATVTGKPEPKITWTKADMLLKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIE
AVNVCGRATAVVEVNVLDKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKVTNYVVERKA
TDSEVWHKLSSTVKDTNYKATKLTPNKEYLFRVAAENMYGVGEPVQAAPITAKYQFDPPG
PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPIKDTTYRV
KGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDVGKTSLVLNW
TKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAG
ESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRD
VRRKGWQTVDTTVKDTKCTVTPLTEGALYVFRVAAENAIGQSDYCEIEDSVLAKDTFTTP
GPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTSGPDCNFR
VTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIA
WKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVN
AVGVSEPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDG
KEVKASDRLTMKSDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCK
DIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI
PNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPIDVEVHNPTAEAMTITWKPPL
YDGGSKIMGYIIEKIAKGEDRWKRCNEHLVPILTYTAKGLQEGKEYQFRVRAENAAGIGE
PSRATPPTKAVDPIDAPKIIMRTSLEVKRGDEIALDATISGSPYPTITWLKDENVITPEE
IKKRVAPTVRRKKGEVQEEEPFVLPLTERLSIDNSKKGESQLRVRDSLRPDHGLYMIKAE
NDHGVAKAPCTVSVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKKDKT
KPDSDWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCISKPLTAKDPFEPPD
APDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNRSLLNSLKTNVE
GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPIPRVTDTSSTTIELEWEP
PAFNGGGEIIGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGE
GPPGETEPVTVAEPQEPPTVELDVSVKAGIQIMAGKTLRIPAIVTGRPVPTKVWTIEEGE
LDKDRVVIENVGTKSELIIKEALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLK
PVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQE
YKFRVIAKNKFGCGPPVETGPILAVDPLGPPTAPERLTYTERTKSTITLDWKEPRSDGGS
PIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNAIGESEPSLPL
NVVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTD
ALKITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL
AVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVEKRYGIWKLI
PNGQYEFRVRAVNKYGTSDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLD
NGGSPITGYWLEKREEGSTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAA
GIGPPSEPSDPAIAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQ
EEGTTDWKRVNEPDKLLTSCECVVPNLKELRKYRFRVKAVNEAGESEPSDATGEIPATDI
QEAPEVFIDIGAQDSLICQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED
AQLETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTASCRVKVMDVPGPPKDLKVSDIT
RGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFLVPDLISEQQYFFR
VRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVT
HYIVECLAWDPTGKKKEAWKQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSA
TVGPVIVKDQTCPPSIDLKEFMEVEEGTDVSIVAKIKGVPFPTLTWFKAPPKKPANKEPV
LYDTHVNKLVVDDTCTLVIPQSRRSDTALYTITAVNNLGTASKEMRLNVLGRPGPPVGPI
KFESISADQMTLSWLPPLDDGGSKITNYVIEKREANRKTWVRVSDEPKECTYTIPKLLEG
HEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDG
GSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGAG
PASLPSDPVTARDPVAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGK
EEWEKGKDKEVRGTKLVVTGLKEGAFYRFRVRAVNIAGIGEPGEVTDAIEMKDRIVSPDL
QLDASVKDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEATIETTAISSSMVIKN
CQRSHQGIYSLLAKNAGGERKKTIIVDVLDVPGPVGTPFLSDNLTNDSCKLTWFSPEDDG
GSPITNYVIQKREADRKAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGIGPFIET
PNELVIRDPITVPERPEDLEVKEITKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFH
KVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDF
RDKLTVRVGEAFALTGRYSGKPKPKVTWFKDEADVLEDDRTHIKTTPTTLTLEKIKAKRS
DSGKYSVVVENSTGSRKGFCQVNVVDRPGPPVGPVNFDEVTKDHMVISWKPPLDDGGSEI
TNYIIEKKEVGKDVWMPVTSASAKTTCKVTKLLEGKDYIFRIHAENLYGISDPLVSDSMK
ARDRFRVPDAPEQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTKDP
IHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDT
TCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQT
YKFRVIAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKG
VPFPKVTWKKEDREAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKV
LVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERRDVASAQWSPLSTTSK
KKSHWAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKAVDPLHPPGPPKDLHHVDVDKT
EVSLVWNKPDRDGGSPITGYLVEYKEEGTEDWIKFKTVTDLECTVTGLQQGKTYIFRVRA
ENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKW
TTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSRTVAVHLTVLDVP
GPPTGPIDILDVTPEHMTISWKPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSIKMKLK
VPHLQKGCEYVFRVRAENKMGVGPPLDSIPTVAKHKFNPPSPPGKPVVTDITENAATVSW
TLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAG
LSNPSPSSDPIKACRPIKPPGPPINPKLKDKTKESADLVWTKPLSDGGSPILGYVVECQK
AGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILH
PPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVQEKRVDIIRDLPRV
ELQIKEAIRADHGKYIISAKNSCGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTIAWEN
PLDNGGSEITNFIVEYRKPNQKGWSIVASNVTRRLIKANLLANDEYYFRVCAENKVGVGP
TIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGS
ADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLD
LKLSGVLTVKAGETIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKIDTSADSSKFSLT
KAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKISDVSSDRCTIRWDPPEDDG
GCEIQNYILEKCESKRMVWSTYSANVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTES
KPVIAKTKFDRPGRPDPPDVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSIRWVP
VNKSAIPERRLKVQNLFPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNLK
VVDTTKSSITLGWGKPVYDGGSPIIGYVVEMRPKKPDTSPDEGWKRCNAAAQLVRMEFTV
TSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPI
RLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPA
GEKAVFVNVRVLDTPGPVSDLKASDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKT
WSTVNPEVKKTSFQVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRK
LEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLIVTGLK
EGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYG
KPHPICKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKI
KVIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALA
SVTKTSCRIGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVN
KDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLVEGLEYSF
RIYALNKAGSSPPSKPTEYVTARTPVDPPGKPEVIDVSKSTVSLIWARPKHDGGSKIIGY
FVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAINISQPSEPSDPV
TIIAENVPPRIDLSLAMKSLLTVKAGTNVCLDATVFGKPTPTISWKKDGTLLKPAEGIKM
AMKRNLCTLELFSVKRNDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDR
AMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA
ENKYGVGDPIFTEPAIAKNPYDPPGRCDPPVISNITRDHMTVSWKPPADDGGSPITGYLV
EKRETQAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARD
PQYPPGPPAFPKVYDTTRSSVSISWGKPAYDGGSPIIGYLVEVKRADSVNWVRCNLPEKL
QKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDNHCPKDILIPPEGELDADLRKTLI
LRAGVTLRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKY
ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPVINYVVE
KRDAERKSWSTVATECPKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETP
GPVVDLKVLSVTKSSCSIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLNLQYSTKD
LTEGKEYTFRVSAENENGEGTPSEITVVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKI
PIKGKPAPSVSWKKGEDPLVTDRRISVESSAVNTTLAVYDCQKSDAGKYTITLKNVAGTK
EGTLSIKVVGKPGIPTGPIKFDEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWV
TCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNI
VDVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLMWKRANKTPIRMKEFRVTGLTEGL
EYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHK
LTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLIEGGKYEFRIRAKNTAGAISAPSEST
GTIICKDEYEAPTIVLDPTIKDGLTVKAEDTIVLSAISILGKPLPKSSWSKAGKDIRPSD
VVQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNV
SAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYLF
RVSAVNQYGKGEPVQSAPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPTDDGGSEIT
GYHVERREKKGLRWVRATKMPVSDLRCKVTGLQEGNSYEFRVSAENRAGIGPPSDASNLV
LMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEDWIKDTT
GTALRITEFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIVEREMAPDFELDAELQR
TLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGK
FVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDVTKDSVTLHWDLPLIDGGSRITNYIV
EKREATRKSYTTATTKCHKCTYKVTGLTEGCEYFFRVMAENEYGIGEPTETTEPVKASEA
PLPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVV
KNLTEGEEYTFQVMAVNSAGRSAPRESRPVVVKEQTMLPELDLRGIYQKLVIARAGDNIK
VEIPVLGRPKPTVTWKKGEQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIV
GEVGDVITVQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDST
TWVELATTVIRTTYKATRLTTGMEYQFRVKAQNRYGVGPGITSASVVANYPFKVPGPPGT
PQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSSGLT
DGIAYEFRVIAENMAGKSKPSKPSEPVFALDPIDPPGKPIPLNITRHTVTLKWAKPEYTG
GFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGALSPPS
EPSDAITCRDDIEAPRIMVDVKFKDTVILKAGETFKLEADVSGRPPPTMEWAKDGKELEG
TGKLEIKIADFSTNLVNKDSSRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAV
SEVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNE
YIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGS
EIINYIVERRDKAGQRWVKCNKKTVTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSPTS
PFYKACDAVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQI
VTPPAGLKATSYTITNLIENQEYKIRIYAMNSEGIGEPALVPGTPKAEDRMLPPEIELDA
DLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRF
DSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIK
NYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVK
ASERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVT
EATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGED
LKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTESNSILTIKEACREDVGHYTVKLTN
SAGEATETLNVIVLDKPGPPTGPVKVDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTS
TTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIVAQYPFKVPGPP
GTPFVTLSTKDSMEVRWNEPVSDGGSKIIGYHLERKERNNILWLKLNKTPIPQTKFKTTG
LDEGIEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTY
DGGSKITGYIVEKKELPEGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVLSE
PSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKIDADIYGKPIPTIEWLKGDKEL
SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDKPGPPEGPV
VITGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG
NEYIFRIMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEITTVTKDSMIVVWERPASDG
GSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHNYEFRVSAENAAGLSEPSP
PSAYQKACDPIYKPGPPNNPKVMDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEW
TMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDL
DLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVN
RYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKESVSITWEPPLLDGGSK
IKNYIVEKREATRKAYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADP
IKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNSEKWSECARVK
SLEAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFNNYSVQVG
QDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSPDLTVLTIKEAHKDDGGHYGITV
ANVVGQKTASIEIITLDKPDPPQGPVKFDEVSAESITLSWNPPLYTGGCQITNYIVQKRD
TTTTIWDIVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESNPIVAQYPYKVPG
PPGTPFVTAISKDSMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKV
VNLEEGIEYEFKVYAENIVGVGKASKNSECYIARDPCDPPGTPEAIIVKRNEITLQWTKP
AYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGTI
SKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK
EVEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEG
PVQVTGVTSEKCTLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLL
EGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDS
DGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEP
SPATVYYKACDPVFKPGPPTNAHIIDTTKNSITLAWGKPIYDGGSEILGYVIEICKADEE
EWQIVTPPTGLKVTRFEISKLIEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPEL
DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDN
CDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVKKDSVILVWEPPIIDGG
AKIKNYVIDKRESTRKAYANVSNKCNKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETV
DAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSVVAE
SKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSVQ
AGEDLKIEILVIGRPRPKISWVKDGEPFKQTTRVNIEETATSAILHIKESNKDDFGKYTI
TATNSAGTATESLSIIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEK
RDTTTTTWQMVSATVARTTIKITKLKTGAEYQFRIFAENRYGKSAPLDSKSVIVQYPFKV
PGPPGTPFVTSISKDQMLVQWHEPVNDGGSRVIGYHLEQKEKNSILWIKLNKTPIQDTKF
KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNSVTLKWK
KPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLDTEFTVSGLVEDQRYEFRVIARNAAG
NFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKD
GKELEETAARMEIKSTIQKTTLVVKDCVRTDGGQYILKLSNVGGTKSIPITVKVLDRPGP
PEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVT
KLLPGNEYIFRVMAVNKYGIGEPLESEPVIACNPYKPPGPPSPPEASAISKDSMVVTWAR
PVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVSAENAAGV
GEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYVVEVKEA
TDDEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERLEP
PEIELDADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLV
IDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVTEVKKDSVTLSWEPPLI
DGGAKITNYIVEKREATRKAYATVTNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPA
EITEPVKVSEPPLPPGRVTLVDVTRSTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST
CTQVKTLEATISGLTTGEEYIFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFNTF
NVKATDQLKIDVPFKGRPQATVSWKKDGQTLKETTRVNVSSSKTVTSLSIKEASREDVGT
YELCVSNSAGSITVPITVIVLDKPGPPGPIQIDEVSCDNITISWNPPEYDGGCQISNYIV
EKRETTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSNSSAVVAEYPF
SPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIPNT
QMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCDPVPARDPCDPPGQPEVTNITRKSVSLK
WSAPRYDGGARITGYIIERRELPDGRWLKCNFTNIQETYFEVTELTEDQRYEFRVFARNA
ADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVVSWA
KDGVEIEERARTEIVSTDYTTLLTVKDCVRRDTGQYVLTLKNVAGTRSMAVNCKVLDKPG
PPAGPLEINGLTAEKCSLSWGPPQEDGGASIDYYIVEKRETSRLAWTICEGELRTTSCKV
TKLLKGNEYIFRVTAVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKESMTLCWS
RPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYQVYAENAAG
LSLPSETSPLIRAEDPVFLPSPPSKPQIVDSGKTNITISWVKPLFDGGAPITGYSVEYKK
SDETDWETAIQSLRGTEYTISGLTTGAEYVFRVRSVNKVGASDPSDSSDPQIAKEREEEP
VFDLDSEMKKTLIVKAGASFTMTVPFRGRPVPSVSWSKPDTDLRTRAYIDSTDSRTSLTI
ENANRNDSGKYTLTIQNSLNAASLTLVVKVLDSPGPPANITVHDVTKESAVLSWDVPEND
GGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAE
TKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVIETLEKGQKNWVKC
AVVKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSH
TVYVRAGSNLKVDIPISGKPLPKVTLSRDDVPVKATMRFNIEVTAENLTINLKESVAADS
GKYEITAANSSGTTKAFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTN
YIVLKRETNTAVWAEVSATVARTVIKVMKLTKGEEYQFRIKAENRFGISDHIDSAYVVVK
LPYTTPGPPSTPWVTNVTRESITVSWHEPVSNGGSAVTGYHLEMKDRNSILWQKVNKMVI
RTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSV
NLSWQQPAFDGGSRITGYIVERRDLPDGRWTKASFTNVIETEFTVSGLTQNSQYEFRVFA
RNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYKAGTSVKLRAGISGKPEPTI
EWYKDDKELQTNALLSIENTTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILD
KPGPPGGPIEFKTVTAEKITFLWRPPADDGGAKITHYIVEKRETSRVVWSMVSENLEECI
IKTTKIIKGNEYIFRVRAVNKYGIGDSLESDPVVAKNAFVTPGPPSIPEVTKITKNSMTV
VWNRPVADGGSEISGYFLEKRDKKSLGWFKVLKETIRDTREKVTGLTENSDYQYRVCAVN
AAGQGPYSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVE
MRQGEEEEWTIVSTQGEVRTTEYVVSNLTPGVNYYFQVSAVNCAGQGEPIAMTEPVQAKD
ILEEPEIDLDVALRTSIIAKAGEDVQILIPFKGRPPPTVTWRKDEKNLGSDARYSIQSTD
SSSLLIIPQVTRNDTGKYILTIENGVGEPKSSTVNVKVLDTPAACQKLQIKHVSQGTVTL
FWDPPLIDGGSPIINYVIQKRDATKRTWSAVSHKCSNTSFKVTDLSEKIPFFFRVLAENE
IGIGEPCETTEPVKAAEVPAPIRDLSVKDSTKTSVILSWTKPDFDGGSIITEYVVERKGK
GEQTWSHAGISKTCEIEVSQLKEQSELEFRVSAKNEKGLSDAVTIGPITVKELVITPDVD
LSEIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKIILDIK
NVKKENGGKYTIILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSVIMSWDVPEDD
GGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDSEYQFRVRAENRYGVSQPLV
SNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYNGGSEVTGFHVEKKERNSILWQ
KVNTSPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI
DVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWLRCNFTDVSECQYTVTGLSPGDRY
EFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKAGESLRIKALVQG
RPVPRVTWFKDEVEIEKRMNMEITDVLGSTSLFVRHATRDHRGVYKVEAKNVSGSAKAEI
TVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPVTHYLIEKRETSRLAWALIED
NCEAHSYTATKLITGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTIPDAPGTPEPSNVT
GNSITLTWTRPESDGGNEIQHYILERREKKSTRWVKVISKRPISETRFKVTGLIEGNEYE
FRVMAENAAGVGPASGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGME
IIGYIIEMCKADLGDWHKVNTEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG
TIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSIRADI
HTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGS
VTLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCTRQILKVNDLAEGVPYYFRVFA
ENEYGVGEPYEMPEPLVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEM
RQKGSDFWVEAGHTKLLTLTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIE
PTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMRITTTKDRTT
LSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWAE
PKDDGGTDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVS
KPLESAPIIAEHPFVPPSAPTRPEIYHVSANTMSIRWEEPYHDGGSKIIGYWVEKKERNT
ILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGR
PEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVT
ALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGELVTIRAGSD
LVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKN
ASGTKAVSVVVKVLDSPGPCGNLTVSRITEEKCTLAWSLPQEDGGAEMTHYIVERRETSR
LNWVIVEGECPTLSYVVTKLIKNNEYIFRVRAVNKYGPGVPVESQPIIARNSFTIPSQPG
IPEEVGAGKEHIIIQWLKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTG
LMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTK
PTYDGGADIIGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKG
MSEYSEAVAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKG
IDLANRAIIDTTDSYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSV
KVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEG
TMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVTDVTKSTVTLAWEKPLYDGGS
RLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIV
TAVTVQDLRVLPTIDISTMPQKTIHIPAGRPVELVIPIAGRPPPAASWFFAGSKLKESER
VTVETHTKVVKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKINEI
DATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRTTFKFTRLTEGNEYVF
RVAATNRFGIGSYLQSEVIECRSSINIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVT
GYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINMRGTGKPSRPSKPV
VAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNT
TPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQE
GIFVRQGGVIRLTIPIKGKPYPICKWTKEGQDISKRAMIATSETHTELVIKEAVRDDSGT
YDLVLENKCGKKAVYIKVRVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYI
LERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKT
PLNPPEPPSNPPEILDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTHI
TTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISK
DSVTLQWEKPECDGGKDILGYWIEYRQSGDSAWKKSNKDRIKDRQFTIGGLLEATEYEFR
VFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMTDVTTKLGEAAQLSCQIVGRPLPDI
KWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA
SPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAITWFRGQKLLQNSEHTAIENTEHYT
HLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSVVISW
KPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTSCRIVNLTENAGYYFRVSAQNTF
GISDPLEVSSVVIIKSPFEKPSAPGKPTITAITKDSCVVSWKPPASDGGAKIRNYYLEKR
EKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPQSDVP
IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGY
HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEV
ISIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFLNGVERKDAGFYVVCAK
NRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATT
AERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNY
DEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKV
KGTDQVLVKKEISILNIARHRNILYLHESFESMEELIMIFEFISGLDIFERINTSAFELN
EREIVSYVRQVCEALEFLHSQSIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNF
RLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEY
TFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRR
YYHTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPISGQIMHAVGEEGGY
VKYICKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYIKDITKFDDGTYRCKVV
NDYGEDSSYAELFVKGVREVYDYYCRRIMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG
ENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDKKYTFESDKGLYQLTINSVTTDDDAEYT
VVAKNKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPP
TLKWEKDGKPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQ
VERLRYVKQEFKSQEEHERHVQKQIDKTLRMAEILSGTETVPLTQVAQEALREAAILYKP
AVSTKTVKGEFRLETEEKKEERKLRMPYEVPEPRKYKQTIIEEDQRIKQFVPMSDMKWYK
KIRDQFEMPGKIDRVVQKRPKRIRLSRWEQFYVTPLPRFTDQYRPKWRIPKLTQDDLEMV
RPARRRTPSPDYTFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFS
ASPPSRSPPRFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPAKAETSTSYAELRERHAQ
ASYRQPKQRQRIMAEKEDEELLRPVTTTQRLSEYKSELDHMSKEEKSRKKSRRQREVTEI
TEIEEEYEITKRAQRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDT
ERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLS
QQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTN
TSGVLTLEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEDVPRSV
FPELTKTEAYAVSSFKKTSEMEASSSVREMKSQMTETRESLSSYEHHASAEMRRAAVEEK
SLEEKSTQRKIKSTLAARILTKPRSLTVYEGESARFSCDTDGEPVPTVTWLRGGQVISTS
THRQVTTTKYKSTFEISSVQASDEGSYSVVVENSEGRQEAQFTLSIQKSRVTEKAVTSPP
RVKSPEPRVKSPEGGKPPKRVKSPEPVTSQPKVVSPTETKPTPTEKVQQLPVSAPPKITQ
SLKAEAVKDIAKLTCAVESSALCAKEVSWYKDGKKLKENGHYQFHYSADGTYELKIQNLT
ESDCGEYVCEVSGEGGTSKTNFQFMGQAFKSIHEQVSSISETKKSAQKTAESTETKKSAQ
KTAESTETKKSAQKTAESTETKKSAQKTAESTETKKSAQKTAESTETKKSAQKIAESTEA
KKTEPKAPEPISSKPVIVTGLQDTTVSSDSIAKFTVKVTGEPQPTVIWTKDGKAIAQGGK
YKLSEDKEGFFLEIHKTDTSDSGLYTCTVTNSAGSVSSSCRLTIKAVKDAETQKVSTQKT
SEITSQKKAVVQEEISQKALISEQIKMSEVKSQEKLSLEEEASKVMISEKVKKSEAASME
KSIVHEEITKTSQASEEIRTQAEIKAFSTQMNITDGQKVTLKANIAGATDVKWVLNGVEL
ANSEEYRYGISGSDQTLTIKQASHKDEGILTCIGKTSQGIIKCQYDLTLSKELSNAPAFI
SQPRSQNINEGQNVLFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNVYSLEIQNAS
VSDSGKYTIKAKNFRGQCSATASLTVLPLVEEPPREVVLRTSGDTSLQGSFSSQSVQMSA
SKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQQSFVEMSSSSFMGKSSMTQLESSTS
RMLKAGIRGIPPKIEALPSDISIEEGKVLTVACAFTGEPTPEITWSCGGRKIQNQEQQGR
FHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSI
NT seq 96984 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcaagcgccgacgtttaagcagccgttacaaagcgttgtggtactggagggt
agtgccgcaacctttgaggctcacgttagtggtttcccagttcctgaggtgagctggttt
agggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgacgatccccgccgtgactaaagccaacagtggaagatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcggag
acagcaccacctaacttcgctcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagctgaaatccagagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgcagaagcataccccgaagactccggaacctattcagtaaatgccactaat
agcgttggaagagctacttcaactgctgaattgctggttcaaggtgaagaagtagtgccc
gctaaaaagacaaagacaattgtttcgactgctcagatatcagaaacaagacaaacccga
attgaaaagaagatagaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccgctgggcaacagctgccgcataaaacacctcccaggatacctcctaag
ccaaagtcgaggtctcccacaccaccatccattactgccaaagcacagttggctcgacag
cagtccccatcgccaataagacactccccttccccggtcagacacgtccgcgcacccacc
ccatctcccgtcaggtctgtgtctccagcgggcaggatctccacgtccacgtcccccatc
agatctgttaagtctccactgctcacgcgtaagactcagacagccgccatggtctcaggc
ccggaagtgcctcccccttggaagcaagagggctatgtggcctcatctgaggctgagatg
agagaaactacggtgacaagcgctactcagatcagaacagaagaaagatgggaagggaga
tatggggtccaggagcaaatgaccatcagcggagctgcaggcgctgccgccagcaagtcg
gcaagcgctaccttcgctgcaggggctgtcgctactggtgctacagaggtgaaacaagaa
actgacaaaagtgcagctgttgcgaccgttgttgctgccgttgatatggccagagtgaga
gaaccagttatcagcgctgtagagcagactgctcagaggacaaccacgactgctacgcac
atccaacctgctcaagaacagatgagaaaagaggcagagaagactgctataactacggta
gtagtggctgccgataaagccaaggaacaagaattgaaatcaagaaccagagaagtaatt
acaacaaaacaagagcaggtgcacgtaactcacgaacagataagaaaagaaactgaaaaa
gcatatgtaccaaaagtagtaatttccacaacgaaagccaaagagcaagaaactagaatt
tctggagaagttactacaaagcaagaacaaaaacaagtaactcaagaaacaatgagacag
gaagctgagacaactgctgcttccatggtggtagttgccactgcaaagcccacaaaacaa
gaaacaatttggggagctcaagaagaaattaccatacaagatcaaatgcacataactcat
gaaaagataatgaaagaaactaggaaaacagtagtacctagagtcatagtggccacaccc
aaagtcaaagaacaagatttagtgtcaagaagtagagaaggcatcactaccaaaagagag
caagttcaaataactcaggaaaagatgagaaaggaagctgagaaaactgccttgtctaca
atagcagttgctactgctaaagccaaagaacaagaaacaatactgagaactagagaagga
atggctgctagacaagaacaagtccaagttactcatggaaaggtggacgttgggaaaaag
gcggaagctgtagcaacagttgttgctgcagtagaccaggcccgagtcagggagcccaga
gaacccgggcatcttgaagaatcatatgctcagcaggccacgttagaatatggatataag
gagcatgtttccgccacaaaggtagttgagcatccccagcgtccagcctcagaaccccag
gttgtccctaaagcggtcaagcctagagtgatccaagctccttccgagactcatatcaca
actactgatcaaatgggaatgcatgtatcatcacagattcagaaaactacagatctaaca
actgaaagattagtccatgtggataaacgcccccgtacagcaagccctcattttactgtt
tcaaaaatttctgttcctaagacagaacatggatatgaggcatcaatagccggtagtgct
attgctacattacaaaaagagttgtcagccacatcctctgctcagaagatcaccaaatca
gtgaaggcacctactgtgaagcctgctgagacgagagtgagagcagagcccaccccctca
ccccaattccccttcactgacacaacagagacttacaggagtcaagctggcattgaagtg
aaaaaggaagtaggggtgagcatcactggtagcacggtccgtgaagagcgcttcgaagta
cttcatgggcgtgagaccaaggtaacagaaacagcaagagtacctgcacctgttgaaatc
cctgttactccaccaactttggtctcgggcttaaaaaatgtgactgttatagaaggtgaa
tccgtcaccttggagtgccacatctctggctacccatcaccaaaagtgacttggtacaga
gaagactaccaaatagaaagttccattgatttccagataactttccagagtggaatcgct
cgtcttatgattcgcgaagcctttgcagaagacagcgggcgatttacttgcagtgctgtg
aacgaggctgggaccgtcagcacatcctgctacctagctgtgcaggcgtcagaagagttt
gaaaaggaaaccacagccgcgactgagaaatttacacaagaagaaaaacgcttcgtggag
tcaagagatgtggtaatgaccgatactagcatcacagaggaacgagcagagccaggagaa
cctgctgctcctttcttcattacaaaaccagtggtccagaaactggtggaaggtggaaga
attgtgtttgaatgtcaggttggcggcaacccaaagccccatgtctactggaaaaaatcc
ggtgttcctctaaccagtggatacagatacaaagtgagttacaacaaacaaacgggtgag
tgcaaactggtgatttcaatgacttttgccgatgatgctggagaatacactattgttatt
cgtaataagcatggagaaatttctgcatctgcctccttgcttgaagaagctgagtatgac
tcactgatgaagtctcagcaagaaatgctttatcagacacaaatgactgcattcgtgcaa
gaacctaaagttggagaaatagcacctggatatatatactctgattacgaaaaagaatat
gaaaaagaacaagccttaattaggaagaaaatggccaaagacactatactggtcagaact
tttgtagaagaccaggaattccatatttcttcatttgaagagaggctcattaaagaaatt
gaatacagaataataaagactacactagaagaacttcttgaagaagatagagaagaaagg
atggcagtagacatttctgaatctgaagctgttgaagcaggatttgatttaagactcaag
aattatagaattcttgaggggatgggtgttacttttcattgcaagatgtctggatatcca
ttacccaagattgcatggtacaaagatggcaagcgcatcaaacatggagagaggtaccaa
atggactttctacaagatggcagagctagcttgcgcatacccgttgttcttccagaagat
gaaggaatctatactgcgtttgccagcaattttaaaggaaatgcaatttgctctgggaaa
ttgtatgtggaacctgctgctcctcttggtgctccaactttcatacccacaccagagcca
gtgagcagaatccgatctatctctccacgttcagtgagcaggtctcctatacgcatgtct
cctgcaaggatgtcacctgcacgaatgtctcctgcaagaatgtcccctgggcgtaggctg
gaggaaacagatgagtcacaacttgagagactgtataagccagtatttgtgttaaaacct
gcttctttcaaatgtttagaaggacaaactgccagatttgacttaaaggttgtgggtaga
cccatgccagagactttctggtttcatgatggccagcaagttatcaatgactatacccac
aaagtagtcattaaagaagacggcacccaatcactgattattgtccctgcagcacccagt
gattctggggaatggactgtggttgcccaaaacagggcaggcaaatcttcaatttcagtg
attttaactgtggaagctgtggaacatcaggttaaaccactatttgtggaaaaactgaaa
aatgtcaatgtaaaagaaggttcccgacttgaaatgaaagtcagagctacgggtaaccct
aatcctgacattgtatggttgaaaaacagtgaaatcattgtacctcataaatatccaaaa
atcagaattgaaggaaccaagggagaagctgcccttaaaattgattccactgtcagccaa
gattctgcctggtatactgcaacagctattaataaggctggccgagacacgaccagatgc
aaagtaaatgttgaagttgagtttgcagagcctgaaccagagagaagattaatcattcca
cgagggacatatagagcaaaggagattgcggccccagaactggagcctcttcatttgcga
tatggtcaagagcaatgggaagagggtgacctctacgacaaagagaaacagcagaaacca
tttttcaagaaaaaactcacttccttaagactcaagcgctttgggccggcccactttgaa
tgcagactaacaccaattggcgacccaacgatggtggtggaatggctccatgatggaaag
ccacttgaagcagccaataggcttcgtatgatcaatgaatttgggtattgcagccttgat
tacggagttgcatattctagagatagtggcatcattacttgcagggccactaacaaatat
ggaacagatcacacatctgctactcttattgttaaagatgagaaaagtcttgtggaagaa
tctcaattgcctgaagggaggaaaggcttacagagaattgaggaattagagaggatggct
catgaaggtgcacttacaggtgtaacaacagatcaaaaagagaagcaaaagccagacatc
gtcttgttcccagagccagtaagagtacttgaaggggagactgctagattccgttgccga
gtgacaggttaccctcagcccaaagtcaactggtacctcaatggacagctcatccgcaaa
agcaaaaggttcagagttcgctatgatggcattcattatctggacattgtggactgcaaa
tcatatgatacaggcgaagtcaaggtcactgcagaaaatcctgaaggtgtgacagagcat
aaagtgaaacttgagatccaacagagagaagattttaggtctgtcctgaggcgagcccct
gaaccaaagcctgagtttcacatacatgaagctggaaaacttcagtttgaagtacaaaaa
gtagatagacctgttgacactaccgaagccaaggaaattgtgaagcttaaaagggctgag
agaattactcatgaaaaggtgtctgaagagtcagaagagctgcgtagtaaattcaagcgc
agaacagaagagggatattatgaagccattactgctgtggagctcaaatctcgtaaaaag
gatgaatcctatgaagaactcctgaagaagaccaaagatgaacttctccactggaccaaa
gagctaaccgaagaggagaagaaagcccttgctgaagaaggcaaaatcactattccaact
tttaaacctgataaaattgaattaagtcctagtatggaggcccccaaaatctttgaaaga
atccaaagccaaacagtaggccaaggatctgatgcacacttccgtgtcagagtcgtggga
agaccagatcctgaatgtgagtggtacaaaaatggtgtcaagatcgaacgctccgatcga
atctactggtactggcctgaagacaatgtttgcgaactggtcataagagatgtgactgct
gaggactctgccagcattatggtaaaagccatcaacatagctggggaaacctcgagccac
gcatttttactcgtccaagccaagcaattgatcactttcacacaggagttacaagatgtt
gttgccaaggaaaaagacaccatggcaacctttgaatgtgaaacttcagagccatttgtt
aaagtgaaatggtataaagacggtgtggaaattcatacaggagataaatatagaacacac
tctgacagaaaggttcacttcctctccatattgacaatcaacatggccgatgctgatgac
tacagctgtgtactagtggaagatgaaaatgtaaaaacgacagctaaactaattgttgaa
ggtgcagttattgaatttcttaaagaacttcaggacatagaagttccagaatcattttca
ggagagctagagtgtgtcgtatccccagaaaatatagaaggcaaatggtatcacaatgac
gtggagcttaaatccaatggcaaatacacaattacatctcgccgtggacgtcaaaacctc
acagttaaggatgtgaccaaagaggaccagggagaatacagctttgtggttgatgggaaa
aagacaacttgtaaactaaagatgaaaccccgccccattgctatcctacaaggacttagt
gatcaaaaagtctgtgaaggtgacatcgtccagctcgaagttaaagtctccttagaaaat
gtggaaggtgtctggatgaaagatggccaagaagttcagcccagtgacagggttcatatt
gtgatagacaaacagtcacacatgctgctcattgaagacatgactaaagaagatgctgga
aattactccttcactattccagcccttggattgtcaaccagtgggcgtgtctctgtctat
agtgttgaggtaataacacctctaaaggacgtcaatgtgattgagggtaccaaggctgtg
ctcgaatgcaaagtctctgtccctgatgtgacatccgttaaatggtatttaaatgatgaa
caaatcaagcctgatgatcgcgtacaagccattgtcaaaggcacaaagcagcgactagtg
attaaccggactcatgcttcagatgaaggacggtacaagctgttggttggaagagttgaa
accagctgtaatctctctgtagaaaaaattaaaattatcagaggtcttcatgaccttacc
tgtacagaaacccaaaatgtggtctttgaagttgagctgtcccactcaggaattgatgtc
ttgtggaatttcaaggacaaggaaatcaagcccagttctaaatataaaattgaagctcat
ggaaaaatatataagttgacagttctaaatatgatgaaagatgatgaaggagaatataca
ttttatgctggagaaaatatgacatctggaaaacttactgtggcagggggggccatctct
aagccactcacagaccagactgtagctgaatcccaggaagctgtgtttgaatgtgaagtt
gccaaccctgattctgaaggcgaatggctgaaggatggcaaacacctaccgctgagtaat
gacatcagaagtgaagcggatggccacaaaaggagacttatcattgctgccaccaaattg
gatgacattggagaatacacctacaaggtggccacctctaaaacatctgccaaactcaaa
gttgaagctgtcaaaattaagaagactctgaagaacctcacagtgacggagacacaggag
gctgttttcaccgtcgagctaacacaccctaatgtaaaaggtgtccagtggatcaaaaat
ggggtcgtgctgaaacccagtgacaagtatgatatctcagtgaaaggaacggtttactct
ctgagaattaaaaactgtgccattgtggatgagtctgtttatggcttcaagcttggaagg
ctaggagccagtgccaggctacacgttgagaccgtcaagatcattaaaaagcctaaggat
gtgaccgctttagaaaatgccaccgttgcctttgaagttagtgtttcccatgacacagtt
ccagtaaaatggttccacaagaatgtggagattaagccaagcgacaaacacagactggtc
tcagagaggaaggtccacaaactgatgctgcagcatattgccccctcggatgctggggaa
tatacagctgtggtgggacaactggaatgcaaagctaaactgtttgtggagacattgcat
attacaaaaaccatgaaaaacattgaggtgcctgagacaaaatctgcctcctttgagtgt
gaggtgtctcacttcaatatcccttctatgtggctgaagaatggtgtggaaattgagatg
agtgaaaagttcaaaatagttgtacagggaaaactccaccaactgatcatcatgaacacc
agcacagaggattcagcagaatacacgtttgtctgtggcaatgaccaagtcagtgccacc
ctgaaagtgaccccaatcatgatcacatccatgctaaaggacatcaatgctgaagaaaaa
gacaccattacatttgaagtgacagtgaaccatgaaggcatctcttacaaatggttaaag
aatggtgtggaaataaaatcaactgatagatgccagatgagaactaaaaagctcacacac
tcactgaacatcaggaatgttcactttggagatgctgctgactacacctttgtggctgga
aaagctacttcaacagccacactttatgtggaagctcgtcacatagaatttaggaaacac
attaaggacattaaggttctagagaagaagcgagccgtgtttgaatgtgaagtttctgaa
cctgacatcactgtacagtggatgaaagatggccaggaactgcagattgtggacagaata
acaatacagaaggagaaatatgtccaccgccttctgatcccatccacccggatgtccgat
gctgggcagtacacagtggtggcaggaggcaacatgtccactgctaacctctttgtagag
ggcagagatgttcgcatccgaagcattaaaaaggaggttcaggttattgagaaacaacga
gctgttgttgagtttgaggtcaatgaagatgacgttgatgcccactggtataaagatggc
attgaaatcaatttccaaatacaagaacgacaccaatatgttgtagaaagaagaattcac
cggatgtttatctctgagaccaggcatagtgatgccggtgaatacacctttgtggcagga
aggaacaggagttccgttactctctatgtcaatgctccagaaccaccccaagttctgcag
gaactccaacctgttactgtgcagtccggcaagcctgcccgcttctgcgctgtaatatcc
ggcagaccacagcccaaaatttcctggtacaaggaagagcagctgctttccattggattc
aagtgcaaatttcttcacgatgggcaggagtacacgcttttgctgatcgaagccttccca
gaggatgcagctgtctacacctgtgaagccaagaatgactacggagttgccacaacctca
gcttcactctcagtagaagttccggaggttgtgtctcctgatcaggaaatgccagtttat
cctcctgccatcattaccccacttcaggacactgtcacctctgagggacgaccagcccgt
tttcagtgcagagtttctgggacagatctaaaggtgtcttggtacagcaaggacaagaag
ataaagccgtctcggttctttagaatgactcaatttgaagacacttaccaactggaaatt
gctgaagcttatccagaagatgagggaacttatacttttgttgctaataatgccatgggt
caagtatccagcacagccaacttgagactggaagcccatgaatcaattttgcatgagagg
atcgaacagcagattgaggtggagatgaaagagttttctagttgtcttctgtctgctgag
gaagaaggactccagacctatagctctgaccttcagctatctaatagaaatgaaacactt
gaacttttgtctgaacctccagttcattcaactaaatttgattccaaaaaagaaggcagt
gtcccaatttttatcaaagaaatgtcaaatgctgaaataagcataggagatgtggctaaa
ctgtctgttactgtcactggcattcccaagcctaaaattcagtggttctttaatggagta
atgttaacgccttctgctgactacaaatttgttttcgatagtaatgatcatagcttgatc
attctgttcacaaaacttgaggacgagggagagtatacatgtattgccagtaatgaatat
ggacagacaatatgcagtgcctatctaaaaataaattccaaaggacagaggcacaaagaa
actgaaccaggatcagcagtggagaaacctctgggaaatcttgaaggtccttgtcctcct
tacttccttaaagagttaaaaccaattcactgtactcagggggtcccagccatctttgag
tacatggtgattggagagcctgcgcccaccgttttgtggttcaaagaaaacaaacagctt
tgcaccaatgtatattacactatcattcataatcctgagggttctgggacgtttatcgtc
aacgaccctcagaaggaagacagtggcctctatgtttgtaaagcagagaatatgtggggt
gagtccacctgtgccgcagagttgcttgtgcttttggaagacacagacatgactgatgcc
ccctgcaaagccaagtccacaccagaggctcctaaagattttccccaggtgttgttaaag
ggccctgcaattgaggcatttgactcagagccaggaattgcagctttcgtaaaggacacc
atttggaaggctgcaccccaggcagttctgtcagatactgaaaaaatatcccccggtgcc
acatccaaagaagaaattagttcattaacagtcaagcctctgaaaactttattagctgaa
cctgaagggagttatctacaatctttaacagaagaacctccagctcattcatatccaact
tctggggttgaggaagcacttttaccaaaacaaaagacagtatcttcagtggacaaagag
caaataggaactcttcaaaagcaagaggcacaaagtgctctcatcatgagtcagaactta
gctgagggacatgtggaaagtttcaagagtcctgacatcgaggtctctaacataagctat
gagccccaggttccttcagaacacacgtgcacagaagaaagtgaaattttgatggaaagt
gtgtatcaactggaaagtacagggctagatttggtggccaggactgaggaaggcaagtcc
ttaagttttccactagcatgtgaagaaaagcaggtactgctcaaggaaaaacattctgac
aacttggtgatgccccctaaccaaaccattgagtgtaagaaagagcccatggcaatacag
gtcgtgcaggaggttaggggaagtgacaatctttctaaggaaagtttgctttctggtatt
ccagaagagcaaaggttaaacctgaaaactcagatccgcagggctttgcaagcagcagtg
gccattgagcaaacgagccttttctctgagtggttaagaaacattaaaaatgtggaggtc
aaggccataaactttagccaagagcccaaacgcattatgtgtacctaccttattacctca
ggggagtctctaacagaagaattaaccatcgctattgaaggcatcgatcctcaaatggct
aacttgaaaactgaatttaaggatgccttgtgctctattatatgtgaggaaataaacatc
ttaacagccgaggatcctagaattcagaaaggaaccaaaacaggcttgcaagaagaaatt
gattctttttcagattcacagactgttgaagcaatcactgaaccagaaattgaatctaaa
tatttggtctcaatggaagaggtcagtcacgttaatgtggaaagtcaggtcaaagttgtg
gataccacaactgtccctgatgggattgctacagctactctctctgatgaaaaacaggat
gagttaccaagaccatctgagggtagcttaatcaaagaggctggtcctataatacataag
cccttggcggacactgttgctgaggaaggtgacatcgtaaacctcacgtcatccataaca
aacgccaaagaggtgaactggtattttgagagtaaactggtgccttcagatgaaaagttc
aagtgtttacaagatcaaaatacatacacactagtaatcgacaaagtaaatacagaagaa
catcagggagagtacacctgtgaggccctgaatgacaacggaaaaacagaaacttcggca
aaactcactgtagtcaaaagagctgccccagtgatcaagaggagaatcgagcccctcgaa
gtagccctgggccaccttgccaaattcacctgtgagatccaaagtgcccccaatgtccga
ttccagtggtttaaagctggccgagaaatttacgagagtgacaagtgttctattcgatct
tcaaattacgtctccagcctggaaattctgagaacccaggtggttgactgcggcgagtac
acctgcaaagcttccaatgagtatggcagtgtcagctgtacagccacactaactgtgaca
gaggcatatccaccaacctttctctccagacctaagtccattacaacttttgtgggtaag
gcagccaagttcctctgcacagtgacagggactcctgtgattgaaaccatttggcagaaa
gatggggctgctctatcaccttcccctaaccgcaagatttcggattcagaaaacaaacac
attttagaactctcaaatcttacaattcaagatagaggagtttactcttgtaaggcttct
aacaagtttggagccgatatctgccaagctgagctgatcataatcgacaaaccacatttc
attaaagaattagagcctgtgcaatcggctatcaataagaaaatccaccttgaatgccaa
gtagatgaagacagaaaagtcaccattacatggaataaagatggacaaaaactcccacct
gggaaagattacaagatctattttgaagataaagtagcatcacttgagattccactagcc
aaactaaaagattcgggcacctatgtttgcacagcttcaaatgaggctggaagcagctca
tctacagcaacagtaactatcagagaacctgccacatttattgaaaaattagagccatca
cagctcttgaagaagggagatgccacccagctagcctgccaagtaactggcacccctcca
attaaaataacatggtttgcaaatgatagagaaatcaaggagagcagcaaacacaaaatg
tcttttgtggggtccactgcagttctaagacttacagatgttgccatcgaagacagtggc
gaatatatgtgtgaggcccaaaatgaggctggcagtgaccactgtggtagcattttaata
gtcaaagagtcaccttactttaccaaagaatttaagccaatcgaagtgttgaaggagtat
gatgtcatgttgctggccgaggtggcaggcacgcctccctttgagatcacctggttcaaa
gacaacacaacgttgcggagtggtagaaagtataaaacctttattcaggatcagctggtt
agcctgcagatcctcaagtttgtagctgcagatgctggtgaataccagtgtcgggtgacc
aacgaggtgggcagcagcacctgcagtgccagggtgaccttaagagaaccccccaccttt
gtaaagaagatcgagagcaccagctcccttcgaggaggcacagctgccttccaggcctct
ctgaagggttccttgccaatcacagtgacttggttaaaagacaacgatgaaatcacagaa
gacaataatataagaatgacctttgagaacaatgtggccagtctgtacctcagtggcatc
gaagtcaagcatgatgggaaatatgtctgtcaggccaaaaatgatgcaggaatacaaaga
tgttctgcattactctcagtgaaagaacctgcaacaatcaccgaggaggctgtgtctata
gatgtcacccaaggagacccagccactttgcaggttaaattttcagggactaaggagatt
acggctaaatggtttaaagatggccaagaactgaccctgggccaaaaatataaaatcagc
gtcactgacacagtctctatactgaagattatttctacagaaaagaaagatagtggagaa
tattcttttgaggtccaaaacgatgttgggagaagcagctgcaaggctagcattaatgta
ctagagccaccaaagtttgtaaagaaattagaagcatccaaaatagtgaaagcaggtgac
tcagcacgacttgaatgcaagataactggatccccagaaatcaaagttgtgtggtacaga
aatgaacatgaactctcagccagtgataaattcagaatgactttcattgactcagtggct
gtcatacagatgaacagtcttggtactgaggatggtggggatttcatttgtgaggctcag
aatcctgctggcagcacaagctgcagtaccaaggttatagtaaaagaaccacctgttttt
agcagcttccctcccgtagtagaaaccctaaaaaataccgaagttagtcttgaatgtgaa
ctttcgggaacaccaccatttgaggtggtatggtacaaagacaaacggcaactccgaagt
agcaagaaatacaagattgcatccaaaaacttccatgcaagtattcatattctcaatctg
gaaacttcagatattggtgaataccactgcaaagcacagaatgaagtgggaagtgatact
tgcatttgtactgtaaaattaaaagaaccaccaagatttgcctccaaactgaacagcctc
accgtagtagctggtgagcccgctgagttgcaagcatccatagaaggcgcccagcctatt
tctgtccagtggcttaaagagaaggaagaagtgattagagaaagtgaaaacatcagaatt
acatttgtggaaaatattgcaactctacagtttgcaaaagcagaaccagctaatgctggg
aagtatatctgccaaatcaagaatgatggtggaatgagggagaacatggccacactgaca
gtcttagagcctgcagtcattgtcgagaaggcaggaccaatgacagtgactgtaggagaa
acatgtactctggagtgtaaggtggctggcactcccgaactctcagttgaatggtacaag
gatggaaagctgttgaccagcagccaaaaacacaaatttagtttctacaacaaaatctct
tccttaaagattctctccgttgaaaagcaagatgcaggcacatacactttccaggttcaa
aataatgttggaaaaagcagctgcacagctgtggttgatgtttcagaccgaatggttcct
ccttctttcacacgaagactgaaagatactgctggggtgctgggtacttcttgcatcttg
gagtgcaaagtagctggatcatcacctatctctattgcctggtttcatgagaaaactaag
attgtcagtggagcaaagtaccaaactacgttttcagataatgtctgctcattgcagcta
aattttctagactcatcagatatgggcaactacacatgtgtggctgctaatgttgctggg
tctgatgaatgtcgtgcaaagttgactgtacaagaaccaccctcttttgtgaaagaacct
gaacctttggaagtactaccaggcaaaaatgtcactttcacaagtgtcattagaggaacc
cctccattcaaggttcgctggttcagaggtgccagagaactggtgaaaggagataggtgc
aacatctattttgaagacactgtggcagaactggaattatttaacgtcgacgtgtcccag
agtggagaatacacctgtgtggtttctaacggtgctggccaaacatcctgcaccactcgt
ctctttgttaaaggtttgcttaagtgcatttttgctcttcctattttttgcacactgaca
tttctgtttgtatttttattgtgtttaactgttgtgctttgtcactcaccagaaccagct
acgtttgtgaagaaattgagcgatcattccgtagaaccagggaagtctataattctggag
agcacctacactggaacacttccaatttcagttacctggaaaaaggatggttttaacata
actccatctgaaaaatgcaacatagtcacaacagagaaaacttgcatcctggaaattctg
aatagcacaaaaagagatacaggacagtattcctgtgagattgaaaatgaggcaggaagg
gatgtttgtgaagctctggtatctacattagaaccaccttactttgttatggaattggag
cctctggaggcttcagttggagattcggtttctttacaatgccaagttgctgggacacca
gaaattacagtgtcttggtacaaaggagataccaagttgcggccaactcctgaatatagg
acctactttacaaacaatgtagccacacttgtttttaataaagtgaacattaatgacagt
ggagagtacacctgtaaagccgaaaataatataggaactgcttcttctaagactgtcttc
agaattcaaggtgatattattttagaaattcagaaatttctttttttcttatcctctttt
atctttatgggagatattttcatttcatctactagtgtctcaattattacttatcttcct
acagaacgtcagctcccaccttcctttgcaagacaattaaaggacattgaacaaactgtt
gggttgccagttacactcacctgccgattaaatggctctgcacccattcaagtgtgctgg
tatagagatggggtacttttgagagatgatgaaaatttacagacatcatttgtagataat
gtggcaactttaaaaattttgcagactgacttgagtcactctggccagtattcttgctca
gcttccaatccacttggaacagcgtcttcgagtgctagactgacagcaagagaacctaag
aaatctcccttctttgacatcaagcctgtatctatagatgttattgctggggaaagtgct
gactttgagtgtcatgttactggtgctcaaccaatgagaatcacctggtcaaaagataac
aaggagattcgtcctggaggaaactataccatcacatgtgtgggaaacactccccatttg
agaattcttaaagtaggcaaaggagactcaggtcaatatacttgccaagcaaccaatgat
gttggcaaagacatgtgctctgctcaactcagtgtgaaagaacctccaaagtttgttaag
aaattggaagcttcgaaggttgcaaagcagggggaatccatccaactggaatgtaaaata
agcggttccccagaaatcaaagttttgtggttccgaaatgacagtgaacttcacgaaagt
tggaaatataacatgtcattcattaattctgtggccctcctcaccatcaatgaagccagc
gctgaggacagtggggactacatatgtgaagctcataacggcgttggcgatgccagctgc
agcacagcactgactgtcaaagcacctcctgttttcacccagaagccttctccagtagga
gcccttaaaggttctgatgttatcttacaatgtgaaatttcgggaacccctccatttgaa
gtggtgtgggtcaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatgacttcg
aaaaattttgatgcaagtcttcatatccttaatcttgaagcctccgatataggagaatat
cactgcaaagctaccaacgaggtgggaagtgacacgtgtacttgcattgtcaagttcaaa
gaacctccacgatttgtgaaaaagctaagtgatacctcaaccctcgttggggatgctgtt
gagttacgggctgtagtggaaggcttccagccaatttctgttgtctggctgaaagataaa
ggtgaagtcatcagagagagtgaaagcacaaggatttcattcattgataacattgcgacc
ctccaacttagtagcccagaagcttctaattctggaaaatacgtgtgtcaaatcaaaaat
gatgccggaatgagagaatgttcagcagtcttaactgtactagaaccagccagaatcaca
gagaagccagaacccatgaccatcactaccggaaatccttttgcattagaatgtgtagtg
gccggaacaccagaactttcaaccaggtggttcaaagatgggagagaattatctgcagac
agcaaacatcatatcacatttgtcaacaaagtagcttcacttaagatcccttgtgcagaa
atgagtgacaaggggttatatagctttgaagtgaaaaacagtgttggtaaaagtaactgc
actgtatctgtccatgtttcggatcgagttgtgcctccttccttcatccgcaaactgaaa
gacacaaacgccgtcctgggggcctcagtggttttggagtgccgagtctccggctcggcg
ccgatctcagttggctggtttcaggatggaaatgagatcgttagtgggcctaaatgtcag
tccagcttttcggaaaatgtctgtactttgaatctgaacttattggagccttccgacaca
ggcatatacacgtgtgtggctgccaacgtggctggttctgatgagtgctcagcagtgctg
actgtgcaagaaccaccatcttttgaacaaacgcctgattctgtggaaattttacctgga
atgagcctcacattcaccagtgtcattagaggcacccctcctttcaaggtcaaatggttt
aaaggcagcaaggagctggtgccaggggaatcatgcaccatctctctggaagattctatc
acagaactagagctgtttgaggtggagccattgcagagtggagactattcttgccttgtt
actaatgatgctggcagcgcttcctgtaccacacatctttttgtgaaaggtttgctcttc
tttccaatttgtttatcttttaaatttttctgtcttcacttgaagatgtccattttaccc
tcctattttctccttatagaaccagccacctttgtgaaaagactggctgatctcagtgtt
gagtcaggaagccccatagttcttgaagccacgtatactggcacacctcccatctcagta
agctggatgaagaatgagttccctctttcacagtctccgaactgcagtattactatgaca
gaaaaatctacgatattagaaattcttgacagcacggtagaagattatgcacagtacagc
tgcctgatagaaaatgaggctggtcaagatatttgtgatgctctggtgtctgtcttagaa
ccaccctattttatcgaacctctggaacatgtggaagcagccattggagaacctacaact
ttacagtgtaaagtggatggaaccccagaaattagaatttcatggtataaagagcacaca
aagctacgatcagctcctgcatataaaatgcaattcaaaaataatgttgcctctttagta
atcaacaaagtggatcatagcgatgtgggagagtatacatgcaaagcagaaaacagtgtg
ggggcagtcgcttcttcagctgtgcttgttatcaaagagcgcaaacttccacctaccttt
gcgagaaaactgaaggatgttcatgagactcttggcttcccggttgcatttgaatgtcgc
atcaatggctcagaacctcttcaagtgtcttggtacaaagatggggtacttttgaaagat
gattctaatttgcagacatcttttgttcataatgtagcaactcttcagattttgcgaact
gaccagagtcatgttggtcagtacaactgctcagcttctaatcctcttgggactgcttca
tccagcgctaagctcattcttacagagcatgaagtgcctcctttctttgatctaaagcct
gtatcagtagatcttgctctcggagaaagtggttcttttaaatgtcatgtaactggaact
gcaccaatcaaaatcacttgggctaaagataaccgagagattcgccctggaggcaactac
aagatgactttggtcgaaaatactgccactctgacagttctcaaagtaggcaaaggcgat
gctgggcagtatacctgctatgcaagcaacgttgctggaaaagactcttgttctgctcat
ctgggggtacaagaaccacccaggttcattaagaagctagagccttcaagaattgtgaaa
caggatgactacatgagatatgaatgtaaaataggagggtctccagaaatcaaagtttta
tggtacaaagacgagaccgaaattcaagagagcagtaaattcagaatgtcattccttgac
tcggtggcagtgttggaaatgtacaacctcagtgtcgaggacagcggagactacacatgc
gaggcccgcaacgcagcaggcagtgcgagcagcagcacttccttaaaagtcaaagagcca
cccgttttccgcaaaaagcctcatcccattgagacactgaaaggaactgatattcatctt
gagtgtgaacttcagggtactcccccatttcaagtttcttggcacaaagacaagagagaa
cttaggagcggcaagaagtacaaaataatgtctgagaacttccttacgagtattcacatc
ttgaatgttgacactgcagacattggggaatatcactgtaaagccacaaatgatgtcggg
agtgacacttgtgtcggttctatcactctgaaagcaccaccgagattcgtgaagaaactc
agtgacatttctgccatcgttggtgaagaggttcagctgcagactgctattgaaggcgct
gagccgatttccgtggtgtggttcaaagataagggagaaattgttagagagagtgacaac
atatggatttcttattcagaaaatattgccaccctgcagttttcaagaacagaaacagcc
aatgctgggaagtacacctgtcagatcaaaaacgatgctggaatgcaagagtgcttcgcc
acactctccattctcgaacctgcagcaattgtggaaaagccagaatccataaaagttacc
acaggagacacctgtaccttggagtgcacggtcaccggcacacccgagctcagtactagg
tggtttaaggatggaaaagagctggcaagtgacaacaaatacaaaataagcttctttaac
aaagtatctggccttaagattatcaacgtggcacccagtgacagtggagtatacagtttt
gaggtgcaaaatcctgttggcaaagacagctgcacagcctcggttcaagtttcagaccga
atcgtgcctccttcattcacaagaaaactgaaagaggcgaatggcctgtctgggtcctcg
gttgtaatggagtgcaaagtctatggatcccctccaatctctgtctcttggttccatgag
ggaaatgaaatcagcagtggaaggaagtaccagaccactctgacagataacacttgtgct
ttaactgtgaacatgctggaagaatcagacgccggtgactacacatgtgtagctactaac
gtggctggttctgatgaatgcagtgctcctttgactgtgagagaaccaccgtcttttgtt
cagaaacctgacgccatggatgttttaactggaaccaatgtaactttcacaagtatcata
aaaggaacacctcctttcagtgtcagctggttcaagggtagcagcgaactagtaccaggg
gacagatgtaatgtgtctttggaggattcagtggctgaactggagttgtttgatgtagat
acatcacaaagtggagaatatacctgcatagttagtaatgaagcgggcaaagcatcttgt
acaacacatctctatgtcaaagctccagctaaatttgtgaagaggctcaatgattacagc
atagagaaaggaaaagcactgatcctagaaggtgcatacattgggacccctcccatttca
gtcacatggaagaaaaatggcataaatataactccttctcagaagtgtaatataaccacg
actgaaaaatcttcaatcctggaaattccaagtactgtagtagaggacgcagggcaatac
aactgctacattgaaaatgcttctggaaaagattcctgttcagcacaaatactgatccta
gaaccaccatattttgtcaaacagttggagcctgttaaagtgactgttggagattctgcc
tctttgcaatgccagcttgctgggacccctgaaatcggggtatcctggtataaaggagat
acaaaattgagacccacttccacctgcaaaatgcattttaggaacaatgttgctacactg
gttttcaaccaggttgatagtaatgacagcggagaatacatctgcagagctgaaaacagt
gtgggagaagtttcttcatcaactttccttactgttcaagaacaaaaacttccaccatca
ttttctcgacaattgagagatgttcaagaaacagttggactgccagttgtttttgaatgt
gccataaatggatcagaacctatctcagtgtcttggtataaagatggcaagccattgaaa
gatggcccaaatgtgcaaacatcatttttagataacgtagccactctcaatatttttaaa
acagatcggagccttgcaggccagtattcttgcacagctacaaatcctatagggtctgct
tcttctagtgccaaactcattctcacagagggtaaaaacccacccttctttgacattcgc
attgcccctgtggatgccgttgtgggagaaagtgcggactttgagtgccacgtcacaggg
acacaaccgataaaggtcagctgggccaaagacggcaaagagatacgaagtggtggcaac
taccagattagttatctggaaaacagtgcccatctgacaattctgaaagtagacaaggga
gactctggacaatatacctgctatgctgtgaatgaagtgggaaaggactcttgtgcagct
caacttaatataaaagagaggctaatcccaccaagtttcactaaaaaactctcagagaca
gtagaagaaacagaagggaattctttcaaacttgagggccgtgttgctggttcccagcct
ataactgttgcttggtacaagaataatatagaaatacatccaacttctaactgtgaaatc
acattcaagaacaacgcactgctgctgcaagtcaagaaggcgggcatgggcgatgctggt
ttgtacacgtgcaaactgtcgaatgacgcaggctccgttctgtgtacctcttcagttgtc
atcaaagaacctaagaagccacctgtgtttgatcggcaccttactccagtaaccgtgagt
gaaggagaattcgtgcagctcagctgccacatccagggttcagagccgatcaggatccag
tggttgaaggctggcagagaaataaagccttcagacagatgcagcttcagctttgctaac
ggtactgctgtgctggagctcaaggatgtggctaaagcagattcgggagattatgtgtgt
aaagcttcaaatgtggctggaagcgacacttccaaatcaaaagtgaccattaaagacaaa
ccagccgccgccccagcagctaagaaagcagcagtggacgggaagctcttctttgtgtca
gagcctcagagtatcagagtggtagaaaaaaccactgcgacatttatcgcaaaagttggc
ggtgatccgatccccagtgttaagtggacgaaagggaaatggaggcaactgaaccaagga
ggtcgtgtgtttatccaccagaaagacgacgaagcgaagttggagatcagagacaccaca
aaaactgattccgggttataccgatgtgtcgcattcaataaacacggagaaattgagagt
aatgttaacctccaggtggatgaaaggaagaaacaagagaaaattgaaggagatcttaga
gcaatgctgaaaaagactccagccttaaagagaggctctggagaagaagaagaaattgat
atcatggaacttctcaaaaacgttgatcctaaagaatatgaaaaatatgcccgcatgtat
ggaatcactgacttccgcggtcttcttcaagcatttgaactgttaaagcaaagtcaagaa
gaagagacacatagattggaaattgaggagatagagaagtcagagaaggaagaaaaggaa
tttgaagaactggtatcatttattcaacaaaggctatcgcagacagagcctgtcactcta
atcaaggatattgaaaatcagacagttttgaaagataatgatgctgtgtttgaaattgac
attaagattaattatccagaaatcaagctttcatggtacaaagggactgtaaaactggaa
cccagtgataaatttgaaataaggattgatggtgatcgacatacactcagagtcaaaaac
tgtcaacttaaagatcagggaaattacagattggtgtgtggcccacacattgctagtgct
aaactgactgtaattgaacctgcttgggaacggcatctgcaggacgttactttgaaagaa
ggccagacgtgcaccatgacgtgccaattttctgtgccaaatgtaaaatctgaatggttc
agaaatggcagaatccttaaaccccaaggtagacataaaactgaagtggaacacaaagtc
cataagctgaccattgcagatgttcgagcagaagatcagggacaatacacctgcaaatac
ggagaccttgaaacttcagcagagctcaggattgaagctgaaccaattcagtttacgaaa
cgtatacagaacattgtggtgagcgagcatcaatctgccaccttcgagtgcgaagtatcc
ttcgatgatgccattgtaacatggtacaaagggccaacagaactgactgagagccagaaa
tacaactttaggaatgatggtcgctgccattatatgaccatccataatgtgaccccagac
gatgaaggtgtctattcagtgattgctcgactggagccaagaggtgaagcaagaagcaca
gcagagctgtacttaacaactaaagaaatcaaacttgagatgaagcctcctgatattcct
gactccagagttccaatccctaccatgcctatcagagcagtaccaccagaagaaatccct
tctatggttattcctcctatacctctgttgctaccatcacctgaagaaaagaaaccacca
gcaaaacgtattgaagtgaccaaaaaagctgtgaagaaagatacgaaaaaagttgtcaca
aagcccaaagaagaggcaccaccacctaaagtcccagaggttgtcaagaagcccccacct
cctactgctttaattccagcaaaagctcctgaaattattgatgtatcctcaaaggctgaa
gaagtgaaaataacgaccataaccagaaagaaagaggttcagaaagaaaaagaagctgtg
tatgagaaaaagcaagcagtctacgaggagaagaaagtttacatagaacctctggaagaa
ccttatgatgaactggaggtggagccatatacagagccatttgaagaaccttattacgaa
gaaccagatgaggactatgaagagaccaaggtagaagctaggagggaagttcacgaggaa
tgggaagaagattttgaagaagggcaggaatactatgaaagggaagaaggttatgacgaa
ggggaagaagagtgggaggagacttatggagaaagagaagtaattcaagttcaaaaagag
atttatgaagaatcacatgagagaaaaattccagcaaaagtacctgaaaagaaaaaagca
ccacctcctaaagttgtaaagaaaccagtagttgaaaaaattgaaaagacttcacgaaga
atggaagaagaaacagttcaagtcactaaagtacctgaagtttccaagaagattgttcca
caaaaaccttctcggattccagtgcaggaagaagttgttgaagtaaaagtaccagcggtg
catacaaaaaagatggttatttcagaagaaaagatgttctttgcttctcatacagaggag
gaggtgtcagtcacagttccagaggtacaaaagaaaactgttacagaagagaaaattcat
gttgctgtttccaaaaagattgaacctccacccaaagtctccgagccacccaagaaaaca
gtcccagaagaaatgattcctgtccccattcctaaaaaggtggagcctccaccggccaaa
gttcctgaagttcccaagaaacctgtgccagaggagaaaaagcctgtccctgtacccaag
aaggaacctgctgctcccccaaaagtcccagaggtgcctaagaaacctgtccctgaagaa
aagatgcctgttcctattgcaaagaaaaaggaagttccaccagctgaagttcctgaagtg
cagaagagggttttcactgaagaaaaaataaccattattactcaaagagaggaatctcca
ccaccagcagtgccagaaataccaaagaagaaagttcccgaagaaaaacggcctattcct
cggaaaaaagaggaaattccaccaccacaagtgccagctctgcctaagaaacctgtccca
gaggagaaagtttccgtaccagttcctgtcactaagaaagctcctcctccccgagctgaa
gtttctaagaaaactgtcgtagaagagaagagatttgttgccgaagaaaaactatctgtt
gcagttcctcaaagagcagaagtcacacggcatgaagtatccacagaggaggcatggagt
tacgaagaagaagaagaagagagagtatccatttcagtttatagagaagaatcaagagaa
gaggaggaggaagaagtagaggttacagaatatgaagagatggaagagcctgaggaatgt
gttgtggaagaaatgctgcactttatttctaagagggtagaagctgaaccagccaaagtg
cttgagaaacatgagaagaaaattgtaccaaaaccaaaaattcctgctaaaatagaggag
cgtccaccaacaaaagtttccgaagcacccaagaaaactgtgctggaaaagaaaattctt
gttgcacttcctaaaaaagaaaagatgccaccagctgaagaagagccaaagaaaccagtt
ccagaaaaaagggctctcccaaaagtgactaagatagaagaacttcccgctgccaaagtg
actgagagacacatgcaaattacccaggaagaaaaagttcatgttgccgtaactaaaaaa
gaggagcctccacgagcaagagtgcctgcggaacccaagagagccattccggaagaaaaa
gttctaaaactcaaacctaaaaaagaggaggtgccaccagcacaagtgactgaattcagg
aaaagagctgttaaagaagaaaagatagccatcgaagttccaaaaagagaacctcgtccc
acaaaagaactaactgtaacagaagagaaagagtggtcttacacccgagaagaagaaact
gtttcagtgcaacgggaagaagaatatgaagaatatgaagaatatgattataaagaatac
gaggaatatgaaccaacagaagaatatgaccaatatgaagactatgaagaacgggaattt
gaacattatgaagagtataaagaacaagaagaatacatcacagaaccagagaagcctgtc
ccggtaaagcctgtccaagaagaaccagttcccacaaaaccaaaggcaccaaccgctaaa
gtgcctgaggttcctaagaagccagaggagaaagttcctgtgcccattcctgaaaaagag
aaggctccaccagctagagttcctgaagtacccaagaaacctgtacaggaggagaaaata
ccagtaccagttcctaaaaaggtggaagctccacctgccaaagtgcctgaagtgcccaag
aagcctgtgcccgagaagaaggtaccggttcctgttcctaagaaagtagaggctccacct
gcaaaagtgccagaagttcccaagaagctcatcccagaagaaaagaagccaacacctatt
tcgaaaaaagtggaagttccaccacccaaagttcctgaggtacctaagaaagtggaggaa
agacgaatcattctccctaaagaagaggaagttcccccagttgaagtgtatgaggagcct
gaggagcctcttccagaagaagagattgcagaagaaccacctatccgagaggaggttgag
gaggtggcgccacctagagtgcctgaggtgatgaaggaagccatccctgaaaagaaagtg
cctgtggttcctcctaaaaagccagaagttccacctgctaaagtaccagaagtgccaaag
aaacctgtcttagaagagaaaccagccattcctgttcccaagaaagtggagtctcctcct
ccagaagcatatgaagaacccgaagaaattgctcctgaagaggaagcaccagttcctgtt
gtggaagaggaggaaccagaagccccaccaccggcagtgcctgaagaacctaagaagatt
gttccagagaagaaagttcctatcatcaaaaaaccagaagctccacctcctaaagaacct
gaacctgaaaagaaggttattgagaaaccaaaattcaaaccaaagcccccagctccttct
cctgctccacctaaggaagatgtgaaggagaaaatgttccaactcaaagctgttccgaag
aagaaagttccagaaaaacctgaggttccagaaaaagtggagcttacacctctgaaagtg
cctggaggtgaaaagaaagttcgcaaattacttcctgaacctaaacctcagccaaaggaa
gaagttgttctcaaaagtgttctaagaaagagatctgaagaagaagaacctaaagtagaa
cctaaaaaagtagaaaaaattaaaaaacctgcagtgccagaaccacctccaaaagctgtt
gaagaggttgaagcacctccagctacggtttcaaaatgggaaaagaaagttcctgaacca
gcaaaagtgcctgaaataaagccagcaatacctctccctggacctgagccaaaagtaaag
cctgaaccagaagtgaaaacagtcaaaccacctcccgtggagcctgctccaacccccatc
actgcaccggtaacagtaccagtagttggaaagaaagcagaagctaaaacacctaaagag
gaggctgccaaacctaaaggtcccatcaaaggtgtagccaaaaagacaccttcaccaata
gaagctgaaaggaaaaagttgagaccaggaagtggtggggagaaacctcctgatgaagct
ccattcacctaccagctaaaggctgtgccactaaagtttgtgaaagaaatcaaagacatc
gtcttaactgaagcagagtcggttggctcttctgcaatctttgaatgtttagtctcccct
tccactgcaattacaagctggatgaaagatggtagcaacattcgtgagagcccaaagcac
agattcattgcagatggtaaagacagaaagctgcatattattgatgttcaactttctgac
gctggcgaatacacctgtgttttacgtttgggaaataaagaaaaaacttccacagctaaa
ctgattgtagaagaacttcctgtgcgttttgtaaaaacacttgaagaggaagtcacagta
gtcaaagggcagccgttgtacttaagctgcgagttaaacaaagagcgtgatgtggtctgg
aggaaggatgggaagattgtgacggaaaaacctggcaaaattatacctggggtcattggc
ttgatgcgggccctgaccatcaatgatgcagatgactatgacgctggcacatatacagtt
actgtggaaaacgccaacaacctggaatgttcatcctgtgtaaaagtagtagaagtcata
agagactggctggtgaaacccatacgagatcaacatgtgaaacccaaggggacggctgtt
ttcacctgtcatatagcaagggatactccaaacattaagtggttcaaaggatatgatgaa
atcccctgggaaccaaatgacaagactgagatagtgaaagagggaaaccatgtatacctc
aaaattaagaatgctgttccagaagacatcgatgaatatgcagtggaaatcgaagggaaa
agataccctgcaaagctgacacttggagatcgtgaggtcgaattgcttaaaccaatagag
gacgttaccatttatgaaaaagaaagtgcaagctttgatgcagaaatctcagaagaagac
attcctggacaatggaaactgaagggagaacttctaaggccctcacctacttgtgaaatc
aaagcagaaggtggaaaacgtttcttaactttgcacaaagtcaaactggaccaagctggt
gaagtcctttaccaggcacttaatgcagttacaactgccattttgacagtaaaagaaatc
gaacttgactttgccgtgccactgaaggatgtcactgttccagaaaggcgacaggctcga
tttgaatgtgtactcactcgagaggcaaatgtcatatggtctaaaggacctgatataatc
aagtcatctgacaagtttgacatcattgctgacggaaagaaacatattcttgtaatcaat
gattctcattttgatgacgaaggtgtctatactgcggaagtggatggcaagaagacctca
gcacgattatttgttacaggtgtcagactgaaattcatatcacctcttgaagatcaaaca
gtgaaagaaggtgaaacggcaacttttgtttgtgaactttcccatgaaaaaatgcatgta
gtctggttcaaaaatgatgccaaactccacacgagcagaactgtgctcatctcatctgag
ggcaagactcacaaattggaaatgagagaagtgacactggatgatatatcccagataaga
gctcaagttaaggacctgagctccacagcccacctgaaagtcttagaggctgatccctac
ttcactgtgaaattacatgacaaaactggcgttgaaaaggatgagattattctgaagtgt
gaagtgagcaaagatgtaccagtgaaatggttcaaagacggcgaagagattgttccttca
ctcaaacactctatcaagtcggatggcctgcaccgcgtcttaaaaatcaaaaaggcagaa
cttaaagataaaggcgaatatgtatgtgactgtggcacagacaagacaaaagcgaatctt
aatgttgaggctcgactaataaaagtggaaaaacctctgtatggagtagaattgttcgtt
ggtgaaacagctcgctttgaaattgaactttctgagccagatgttcacggcgagtggaag
ttaaaaggagagcctttaactgcatcccctgactgtgaaatcatcgaggatgggaaaaag
catactctggtcctttataactgtcagctagatatgacaggagaggtgtccttccaggct
gccaatgctaaatctgcagccaatctgaaagtgaaagaattgccacttatcttcatcaca
cctctcagtgatgttaaagtcttcgagaaagatgaagctaagtttgagtgtgaagtatcc
agggagcccaaaacctaccgttggctgaaaggaacccaggaaatcacaggggacgacaga
tttgagcttataaaggatggtactaagcattcaatggtgatcaaatcagttgcttttgaa
gatgaagccaaatacatgttcgaagctgaagataagcacacaagtggcaaactgatcatt
gaaggaatccggcttaaattccttactccccttaaggatgtaacagccaaagagagggaa
agtgctgtgttcactgtggagctgtcccacgacaacatcccagtgaaatggttcaagaat
gaccagcgcctgcataccagcaaggtggtctcaatgcacaatgaggggaaaactcattcg
attacattcaaagacctcacccttgatgatacctctcaaattaaagtagaagctatggag
ttaagttcagaagctaaactcacggtgcttgagggagatccatactttacaggaaagctt
caagattatactgccgtagagaaagatgaagtgattctacagtgcgaaattagcaaaccg
gatgccccagtgaagtggtttaaggatggagaggaaataaagccatctaaaaatgttatt
attaaggcagatggcaagaagcgcatgctaatcctaaagaaagccttaaaatcagatatt
ggacagtacacctgtgactgtgggacagataagacctcaggaaagcttgacattgaagat
cgggaaattaaaatggtgcgacccctgtacagtgtggaggtgatggagactgagacggcc
cgttttgaaactgaaatctctgaagatgatatccatgccaactggaagctcaagggagag
gcactactccaaacacctgattgtgagattaaggaagaaggcaaagtgcacgtgcttatt
ttgcacaactgccgcctggatcagactggtggggtggatttccaagctgccaatgttaaa
tctagtgcccacctccgagtgaaaccacgagtaattggtcttctgaggcctctgaaggat
gtcacagtaactgcaggggaaacagccacattcgactgtgaactctcttacgaggatatc
ccagtggaatggtatctcaaagggaagaaactggagcccagcgataaggtggtcacacgt
tcagaaggaaaagttcatacacttactctgagggatgtaaagttagaagatgctggagaa
gtccgactaacagcaaaagattttaaaactgaagccaacctctttgtgaaagaaccccca
gttgaattcactaagcctcttgaggaccagacggtcgaagaggaagccactgcagtattg
gaatgtgaagtatccagagaaaatgctaaggtgaaatggttcaaaaatggtacagaaatt
ctcaaaagcaagaagtatgaaattgtcgctgatggcagggtcagaaaacttatcatacat
ggctgtaccccagaggatattaaaacatacacttgcgatgctaaggattttaagacctcc
tgtaacctgaatgtcgtgcctcctcatgtggaattcctaagaccacttacagatcttcaa
gttaaagaaaaagaaatggctcggtttgagtgcgaaatttcccgagaaaatgcaaaggtt
caatggtttaaagatggtgctgaaattaaaaagggcaaaaaatatgacatcatatctaag
ggagcagtgcgcattcttgtcatcaataaatgtctgctggatgatgaagcagaatattct
tgtgaagtaaggacagcaagaacttccggcatgctgacagtactggaagaagaagctgtc
tttacaaaaaatcttaacaacatcgaagttagtgaaacagacactataaaactcgtttgt
gaagtctctaaacctggagcagaagtgatttggtacaaaggagatgaagagatcattgaa
acaggaagatatgaaatacttactgatggacgaaagagaattctgatcattcagaatgcc
catcttgaggatgctggcagctacaactgccgactcccaagttctcgaactgatggcaaa
gtcaaagtacatgaacttgctgctgaatttatctcgaagcctcaaaaccttgaaatactt
gaaggagaaaaggctgaatttgtctgctctatatcaaaggagagctttgaagtacagtgg
aagagggatgataagacacttgaatctggagacaaatatgacattatttctgatggcaaa
aagaggatcctggttgtgaaagatgccacgttacaagatatgggtacttatgtggtcatg
gttggggctgccagagcagcagctcacctgacagtaattgaaaaactcaagatcatagtt
cctcttaaggacactcgtgtaaaagaacaacaagaagttgtctttaactgtgaagtcaat
accgaaggtgccaaagccaaatggttcagaaatgaagaagccatatttgatagttcaaaa
tacattattcttcaaaaagatttggtctacaccctcagaattagagatgcacgattggat
gatcaagccaactacaatgtgtctctgaccaatcatagaggtgaaaatgttaagagtgca
gccaatctaatagtagaagaggaagaccttaggattattgagcctcttaaagatattgaa
acaatggagaagaaatctgtcacattctggtgcaaggtgaatcgtctcaatgtaacactg
aaatggaccaaaaatggagaagaggtggcttttgacaaccgtgtttcatacagaattgat
aaatataagcactctttaaccattaaagactgtggcttcccagatgagggtgaatacatt
gtaactgctgggcaagataaatctgttgctgagcttctcatcatcgaagctcctacagaa
tttgtggaacacttagaagaccagacagtcactgaatttgatgatgctgtcttctcctgt
cagctctccagagagaaagcaaatgtaaaatggtacagaaatgggagagaaatcaaagaa
ggcaaaaaatacaaatttgaaaaagatggaagtacacataggctcattataaaagattgc
aggctggatgatgaatgtgaatatgcttgtggagtagaagacaggaggtctcgggctaga
ctttttgtggaagaaatccctgtcgagatcatcaggcctccacaagatattctcgaagcc
cctggtactgatgttgtcttttgggctgagctcaacaaagataaggtggaagtccagtgg
ctaagaaataacatgattattgtccaaggtgacaaacaccagatgatgagtgagggaaag
atacacaggttacagatttgtgatattaggccccgtgaccagggcgaatacagatttatt
gccaaagacaaagaagccagagctaagcttgaactggcagctgcacctaaaatcaagaca
gctgatcaagaccttgtggttgatgtcggccagcctttgacaatggtggtgccctatgat
gcctaccctaaagcagaagctgagtggtttaaagaaaatgaagctctgtcttcaaaaact
gttgatactacagctgaacaaacttctttcagaattttagaagcccagaaaggtgacaaa
ggaaggtataaaattgtgcttcagaacaaacacgggaaagcagaagcatttatcaattta
caagttattgatgttcctgggccagtgcgtaacttagaagtaacagaaacttttgatggt
gaagtgggccttgcttgggaagaaccattaactgatggtggaagcaaaatcataggttat
gttgttgaaagacgtgacatcaagagaaagacctgggttctggccactgaccgtgcagac
agttgtgagtttactgtcactggactacaaaaaggaggagttgagtatctattccgtgtg
agtgcaagaaacagagttggcactggtgaaccagtggaaactgacaatcctgtagaagca
aggagtaaatatgatgttccaggccctcctttgaatgtaaccatcactgatgtgaataga
tttggtgtctcattgacatgggaaccaccagagtatgatggtggtgctgagatcacaaac
tacgtcattgaattaagggacaagacttctatcagatgggacacagccatgacagtaaga
gctgaagacctgtctgcaactgtcaccgatgtggtggaaggacaggagtatagtttccga
gtcagagcccaaaacagagttggagttggaaaaccaagttcagccacacctttcgtcaaa
gtcgctgatccaattgagagaccaagtcctcctgtgaacctaaattcctcagatcagact
cagtcatcagttcagcttacatgggaacctcccctgaaagatggaggaagcccaatcttg
ggctatataatagagcgatgtgaagagggaaaagataactggattcgttgcaatatgaaa
ctggtccctgaactgacttacaaggttactggattacaaaaaggaaataaatatttatat
cgagtatctgcagaaaatgaagctggtgtttcagatccatctgaaattcttggtcctcta
actgctgatgatacttttgttgaaccaacaatggacttaagtgcctttaaagatggtctg
gaaattattgttccaaatcctatcaagatcctgattccaagtacaggctatccaaggcca
actgcaacctggtcttttggagatcaagttctagaagcaggggaccgtgtgaaaatgaaa
actttatctgcatatgccgaacttgtcatttctccaagtgaacgtccagacaagggcatt
tatacactgtatcttgaaaatccggtgaaagcaatttctggggaaattaatgtcaatgta
attgctcgcccaagtgcacccaaagaactgaaatttgatgacataaccaaggactcagta
catttgacttgggaaccaccagatgatgacgggggaagtccattaactggatatcttgtt
gaaaagcgagaagtcagccggaaaacatggactaaagttatggacttcgtgactgactta
gaattcacagtccccgatcttgttcaaggaaaggagtatttatttaaagtctgtgctcgt
aacaagtgtggccctggggaacctgcatatgttgatgagcctgtgaatatgtcagctcct
gcaacggtacctgatccaccagagaatgttaaatggagagatcgaacagccaagagcatc
ttcctaacatgggatccacctaaatatgacggtggttcacgcatcaaaggatatttagtt
gaaaaatgtccacgtggttctgatcgatgggttgcctgtggagaaccagttgcagagaca
aaaatggaagtaacaggtcttgaagaaggcaaatggtattcctaccgtgttaaggccttg
aacaggcaaggtgctagcaaaccaagcaaacccacagatgaaatccaggctgtggacaca
caggaggctccagaaattttccttgatgtgaagctccttgctggtctcactgtaaaagca
ggaactaagattgaacttcctgccactgtaactggaaaacctgaacctaaaataacttgg
acgaaggctgatatgcttctgaagcaggacaaaagaatcaccattgaaaatgttcctaaa
aaatccacagtgactattgtcgatagtaagaggagtgacactggcacatacatcatcgag
gctgtgaacgtctgtggtcgagccactgctgtagtagaagtaaatgtcttagataaacca
ggaccacctgctgcttttgacatcacagaagtgaccaatgagtcatgtcttttgacatgg
aacccaccacgagatgatggtgggtctaaagtcacaaactatgttgtggagagaaaagca
acagacagtgaagtgtggcacaagctctcatccactgtcaaggatacaaactacaaggca
accaaattaacacccaataaagaatacctcttcagagttgctgcagaaaacatgtatggt
gttggcgagccagttcaggccgctcctataacagccaaatatcagtttgatccacctgga
cctccaactcgcctagaaccttctgatatcactaaagatgcagtgactcttacatggtgt
gagccagacgatgatggtggcagcccaatcactggatactgggttgaaagattagatcct
gatactgataaatgggttagatgcaataagatgccaataaaggacacaacatacagagta
aaaggtctcaccaataagaagaaatacagattccgtgtgctggctgaaaatcttgctgga
cctgggaaaccaagtagatcaactgaaccaatcttaataaaagaccccatagatcctcca
tggccccctggaaaaccaactgtgaaagatgtaggcaaaacatcattagtattgaattgg
acaaagccagaacatgatggaggagcaaagattgagtcttatgtcattgaaatgctaaag
actgggacagacgagtgggtccgagtggctgaaggagttcccaccactcagcatctgctc
ccagggctcatggaagggcaggagtactcattccgagttagagctgtgaacaaggctggg
gaaagtgaacccagcgaacccagcgaccctgtgctttgccgggagaaactatatcctcca
tcaccacctcgctggcttgaagttattaatatcacaaaaaatacagcagacctaaaatgg
acagttcctgagaaagatggaggatctcccatcaccaactacattgtggaaaagagagat
gtgagacgaaaaggctggcaaacagtggacacaactgtcaaggacaccaagtgtactgta
accccactgacagagggcgctttatatgtgttccgagtagctgcagaaaatgccatagga
caaagtgactactgtgaaattgaagactctgtcttggccaaagacacctttaccacccct
ggaccaccctatgctctgacagttgttgatgtgacaaagcgacatgttgacctgaagtgg
gaaccacctaagaatgatggtggaagaccaatacagagatatatcattgaaaagaaagaa
aaattaggtacccgttgggtgaaagctggaaagacatcaggacccgactgtaacttcaga
gtaactgatgtcattgaaggcacagaggtccagtttcaggttcgggcagaaaatgaagct
ggagttggtcacccaagtgaacccacagaaatcctgtcaattgaagatccaacaagtcct
ccttcacctcctcttgacctacacgtgactgatgctgggagaaagcacattgccattgct
tggaagcctccagagaaaaatggcggaagtcctattataggataccatgttgaaatgtgc
ccagtgggcactgagaaatggatgcgggttaattctcgcccaataaaagacttgaaattc
aaggttgaagaaggtgttgttcctgacaaggaatatgttctgagagtgagagctgtcaat
gctgttggtgtcagcgagccatctgaaatctccgaaaatgtggttgccaaagacccagac
tgcaagccaacaattgatctggagactcatgacattgttgttattgaaggtgaaaaacta
agcatccctgttcccttcagagctgtcccagttccaactgttagttggcacaaagatgga
aaagaagttaaagcaagtgatagattaacaatgaaaagtgaccacatctcagcacacctc
gaagttcccaagagtgtccatgcagatgctggagtttataccattacactggagaacaag
ctcggttcagcaactgcctcaatcaatgtcaaagtcataggcctacctggaccatgcaaa
gatattaaagcaagtgatgtcaccaagagttcttgtaaattaacctgggaacctccagaa
tatgatggtggaagcccaattcttcattatgtcctggaacgcagagaagctgggaggagg
acatatataccggtcatgtccggtgagaataaactatcttggactgtaaaagatctcata
ccaaatggtgaatatttcttccgcgttaaagctgtcaacaagattggtggaggcgaatat
atagaactgaaaaatccagtcattgctcaagatccaaagcagccccctgatccacctata
gatgtcgaggttcataatcctacagctgaagcaatgactattacatggaagccaccttta
tatgatggagggagcaagataatgggttatatcatagagaagattgctaaaggtgaagac
agatggaagagatgcaatgaacacctggtaccaatcctgacctatacagcaaaaggactt
caagaaggaaaggaataccaattccgtgtgcgagcagaaaatgctgctggtattggtgag
ccttctcgggccactcctccaaccaaagctgtagatcctattgatgctccaaaaatcatt
atgagaacaagcctagaagtgaaacgaggtgatgaaattgcacttgatgcaactatttct
gggtccccttacccaactattacatggctaaaggatgaaaatgttattacaccagaggaa
atcaagaagcgagtagcacccacagttagaaggaagaagggtgaagttcaggaagaagaa
ccatttgtcctgcctctgacggagcgtttgagtattgacaatagtaaaaaaggagaatct
cagctacgtgtccgagattctctccgaccagaccatggcctgtatatgatcaaagctgag
aatgaccatggtgtcgcaaaagctccttgtactgtcagcgtgcttgatacaccaggacca
ccaatcaactttgtatttgaagatattagaaagaactcagtcctctgcaaatgggaacca
ccccttgatgatggtggcagtgaaattataaactacactttagaaaagaaagataagaca
aaacctgactcagactggattgttgtcacctcaacacttagacactgcaaatattcagtg
acgaaactgattgaaggaaaagagtacctcttccgtgtaagagctgaaaataggttcggg
cctggaccaccatgtatttcaaagccacttacagctaaagatccatttgaaccacctgat
gcacctgataaacccattgtggaagatgttactagcaacagtatgctagtgaaatggaat
gaaccaaaggataatggaagccccatcttgggttactggctcgaaaaacgtgaagttaat
agtacacattggtctcgtgtcaacagaagccttctgaattctctgaagaccaatgtagaa
ggcctattagaaggactaacctatgtcttcagagtatgtgctgaaaatgcagctggacct
ggaaaattcagtcccccttcagatcccaaaaccgcacgtgatccaatctctccaccaggg
ccacctatcccaagagtcactgacacaagctctacaactattgaattagaatgggaaccc
ccagctttcaatggtggtggagaaattattggctattttgtcgataagcagctggttggc
acaaatgaatggtcacgctgcacagagaagatgatcaaggtccgtcagtacactgtcaaa
gaaatccgagagggtgctgattataaacttcgagtgagtgctgtcaatgctgcaggagaa
ggaccacctggagaaacagaacctgttactgtggctgaaccacaagagcctccgactgtg
gaactagatgtttctgtcaaggctggaatacaaataatggctgggaaaactctaagaatt
ccagctatagtaactggccgtccagtgcctacgaaagtatggactattgaagagggagag
ctggataaagaccgtgttgtaatagaaaatgttggaacaaaatctgaactaattatcaag
gaagcattgagaaaagatcatggcagatatgtgattacagccaccaatagctgtggttct
aaatttgcagcagcccgggtagaagtttttgatgtccctggtccagttcttgacttaaaa
cctgttgtaacaaacagaaagatgtgtctacttaactggtctgatccagcagatgatgga
ggaagtgaaatcacagggtttattattgaaagaaaagatgccaagatgcatacttggaga
caaccaatagagactgagagatctaaatgtgacatcacaggtctccttgagggacaagaa
tataagttccgtgtgattgccaagaacaagtttggctgtggccctcctgttgaaacagga
ccaattcttgcagttgatccactaggtcctccaacagctcctgagaggctcacatataca
gaaaggacaaagtctaccatcacccttgactggaaagagccccgcagtgatggtggcagc
cctatccaaggctatatcattgaaaaacggcgtcatgacaaacctgactttgaaagagtt
aacaagcgactctgcccaaccacatctttcctggttgaaaatcttgatgagcaccagatg
tatgagttccgggtcaaagctgtcaatgcaattggtgaaagtgaaccatccttgcctctt
aatgtggtcatacaagatgatgaagtgcctccaactattaaactgcgcctggctgttcga
ggagatactatcaaagtaaaggcaggagaacctgttaacatccctgcagatgtgacaggc
cttccaatgcctaagattgagtggtccaagaatgaaactgtgattgaaaaacccactgac
gcactgaagataaccaaagaagaagtatcccgaagtgaggcaaagactgagctcagcatt
cccaaagctgtccgggaggacaaaggcacttacacagtgactgcctccaatcgtcttggc
tcagtcttccgaaatgttcatgttgaagtatatgatcgtccatccccaccaagaaatctt
gcggttactgacattaaagctgaatcttgctacttgacatgggatgcccctctagacaat
ggcggcagtgaaatcacccattatatcattgacaaacgtgatgcaagtaggaagaaaagt
gaatgggaggaagtcaccaacactgctgtagagaagagatatgggatctggaaacttatc
cccaatggtcaatatgaattccgagtgagggcagtgaataaatatggaaccagtgatgag
tgcaaatcagataaagtggtcattcaagatccttaccgccttcctggacctccgggaaaa
ccaaaagttttggagcgcaccaaagggtcaatgctagtgagctggactcctcctttagac
aatggtggctctccaattactggctactggctggagaagagagaagagggaagtacctac
tggtcacgtgttagccgagcaccaataaccaaagtgggattgaaaggagtggaatttaat
gttccccgtttgattgaaggcgttaagtaccagttcagagcaatggcaataaatgctgca
ggaatcggccctcccagtgaaccatcagatccagctattgcaggagatcccatatatcca
cctgggccaccatcttgcccagaggtcaaagacaaaacaaagtcaagcatctcactagca
tggaaacctcctgccaaagatggtggcagtccgatcaaaggatacattgtagaaatgcaa
gaagaaggtactactgactggaaaagggtaaatgaaccagataaacttctaactagttgt
gaatgtgtggtgccaaatttgaaagaactcaggaagtatagattcagagtgaaagctgtc
aatgaagctggtgaatcagaaccaagcgatgcaactggagagatccctgccactgatatt
caagaggcaccagaagttttcattgacattggagcacaagactctctgatatgtcaagct
ggttcacagattaggattcctgctgtcatcaagggacgccccacaccaaaatcatcttgg
gaatttgatggaaaggcaaagaaggcgatgaaggatggagttcatgatatacctgaagat
gcacagctggagactgcagaaaactcatcagtgattattatcccagagtgtaaacgatct
cattcagggaaatatagcatcacagccaagaataaagcaggacaaaaaactgcaagttgc
agagttaaagtcatggatgtaccagggccaccgaaagatctgaaagtcagtgacatcaca
agaggtagttgcagacttacatggaagatgccagatgatgatggaggagacaggatcaaa
ggctatgttattgagaagaagactattgatggaaaagcctggactaaagtcaatccaaac
tgtggaagcaccacatttttagttcctgatctcatctctgaacagcaatatttcttccgt
gtacgtgcagaaaaccgttttggtattggcccacctgtggaaaccattcagaggaccact
gccagagatcccatatatcctcctgatccccctattaaactcaagattggcctgataaca
aagaatacagtacacctgtcatggaaacccccaaagaatgatgggggctcccctgtcacc
cactatattgttgagtgccttgcctgggaccctactgggaaaaagaaagaagcatggaaa
cagtgcaataggcgtgatgtggaagaactggaatttactgttgaagacctcatagagggt
ggagaatatgaattcagagtcaaagctgtcaatgctgcaggagtcagcaaaccttcagcc
actgttggccctgtgattgtcaaagaccagacatgtccgccatcaattgatctaaaagaa
ttcatggaggttgaagaaggaactgatgttagcatcgtggccaaaattaaaggtgttcca
ttcccaacactaacttggtttaaagctcctccaaagaagcctgcaaataaagaacctgtt
ctctatgacacccatgtcaacaaactggtggtggatgatacttgcaccttagttattcca
cagtctcgcaggagtgacactgccttatataccattacagccgtgaataatctgggaaca
gcatcaaaggagatgagattgaatgtccttggtcgtcctggccctccagtgggaccaata
aagtttgaatctatttcagcagaccaaatgacattatcctggcttccacctttagatgat
ggtgggtctaagattacgaactatgtaatagagaaaagagaagctaataggaagacatgg
gtgcgtgtctctgatgaacctaaagagtgcacgtacacaattcccaaattgctagaaggc
catgaatacgtattcagaatcatggcccagaataaatatggcattggggagcctcttgac
agtgagcctgaaacagcaagaaacctcttctctgtccctggagcaccagataaaccaaca
gttagcagtgtgactcgtaactctatgactgtcaactgggaagagccagaatatgatgga
ggctctcctgtgacaggatactggctagaaatgaaagacaccacttcaaagagatggaag
agagttaaccgagatcctatcaaagccatgactttgggtgtttcttataaagtgactggt
cttattgaaggttctgattatcagttccgagtatatgcaatcaatgctgctggtgcggga
ccggcaagcctgccatcggatccagtgactgctagggatccagttgcccctcctggtcct
ccatttcccaaagtcacagactggactaagtcatccgcagacttggagtggtctccccca
ctaaaggatggcggatccaaagtaactggatacatcgttgaatataaagaagaaggaaaa
gaagaatgggaaaagggtaaagataaagaagtgagaggaacaaaacttgtcgtgactgga
ttaaaggaaggagcattctacagatttagagttcgagcagtcaatattgctggcattgga
gaacctggagaagtcacagatgccattgaaatgaaggacagaattgtatcacctgacctt
cagctagatgccagcgtcaaagacagaattgtggtccatgctggaggggtgatccggatc
attgcctatgtatctggaaagcctcctccaactgttacctggagcatgaatgaaagagca
ttacctcaagaagccaccattgagactacagccattagctcatccatggtcatcaagaat
tgccagaggagccaccaaggcatctattctcttcttgccaaaaatgcagggggagaaagg
aagaaaacaattattgttgatgttttagatgtgccaggtcctgttggaacaccattcctg
tccgacaatctaactaatgactcctgcaaactgacatggttttctccagaagatgatgga
ggctctccaatcaccaattatgtcattcaaaagcgggaagctgaccgcaaagcatggacc
ccagtgacatatacagttacccgacaaaacgctactgtccagggtctcattcaaggaaaa
gcctactttttccgaattgcagctgaaaatagcattggcataggcccgttcattgagaca
ccaaatgaacttgtcatcagggatccaataactgtaccagagcgtcctgaagacctggaa
gtcaaagaaattactaaagattctgttactttgacttggaatcctccaaagtatgatggc
ggatcagaaattattaactatgtcctagaaagccgtctcattggaactgagaagttccac
aaggttacaaatgacaacttgcttagcagaaaatacactgttaaaggcttaaaagaaggt
gatacctatgagtatcgtgtcagtgccgtcaatattgttggacaaggcaagccctcattt
tgcaccaagccaatcacttgcaaggatgagctggctcctccaacacttgaccttgacttc
agagataagctcacagttcgagttggtgaagcttttgccctcacgggccgttactcaggc
aaaccaaagcctaaggttacttggttcaaagatgaagctgatgtactagaagatgatcgc
acccatataaagaccactccgacaacacttactctagagaagatcaaagccaaacgttca
gactctggcaaatactctgtggttgtggagaatagtacaggctctaggaaaggtttctgt
caagttaatgttgttgatcgtcctggaccaccagtaggaccagttaattttgatgaagtg
accaaagatcacatggttatctcttggaagccacctttagatgatggaggcagtgaaatt
accaattatattattgagaagaaggaggtgggcaaagacgtttggatgcctgtgacatct
gcaagtgcgaaaacaacatgcaaagttactaaactgcttgaaggaaaggattatattttc
cggatccatgctgaaaatctgtatggaataagtgatcctctggtgtctgattctatgaaa
gccagagatcgttttagggttcctgatgcacctgagcagccaattgttacagaagttacc
aaagactctgcattagtaacctggaataagccaaatgatggaggaaagcccatcacaaac
tacatcctagaaaagagggaaactatgtctaaacgatgggctagagtgaccaaagatcca
atccatccatacactaaatttagggttcctgatcttctagaaggatgtcagtatgaattc
cgggtatctgcagaaaatgaaattggtattggagatccaagcccaccatcaaaaccagtc
ttcgctaaagatccaattgctaaaccaagtccacctgttaatcccgaagcaatagataca
acatgtaattcagtggacctaacttggcagccaccacggcacgatggtgggagcaagatc
ctgggttatattgttgagtaccagaaagtcggagatgaagagtggagaagagccaatcac
actcctgagtcatgtcctgaaactaaatataaagttactggtcttcgagatggtcaaacc
tataaattcagagtaatagcagtcaatgaagctggtgaatcagatccagctcatgttcct
gagccagtgctagtaaaagacagacttgaaccccctgagttgattcttgatgccaacatg
gcaagagaacagcacataaaggttggtgatactctaagacttagcgccatcatcaaagga
gtgccattcccaaaagtaacttggaaaaaagaagacagagaggctccaactaaagcaaga
attgatgttactccagttggtagcaagcttgaaattcgtaatgctgcccatgaagatggt
ggaatttattccttaacagtggagaatccagctggttcaaaaactgtctcagtaaaagtg
cttgtattagataagcctgggccacctcgagatctggaagtcagtgaaattaggaaagat
tcttgttaccttacttggaaggaaccactggatgatggtggttctgttgttacaaattat
gtagttgagaggagagatgttgccagtgcccagtggtcgcctctttcaactacatcaaag
aaaaagagccactgggctaaacatcttaatgaaggtaatcagtatctcttccgagtagct
gctgagaaccagtatggacgtggtccttttgttgaaacacctaaacccatcaaggctgtg
gatcctctacatccccccgggccacccaaggatctacaccatgtagatgttgacaagact
gaagtctcccttgtttggaataagccagatcgtgatggtggctctccaattactggatat
ttggtggaatataaagaagaaggcactgaagactggattaaattcaagactgtgacagac
ttagagtgtactgttactggactacaacaaggaaagacctatatattccgtgtaagagcc
gaaaatattgtgggtcttggtctccctgacacaacaatcccaatagagtgtcaagaaaaa
ctagtgcctccatctgtggagctggatgtgaagttaattgaaggccttgtggtaaaagct
ggaactacagtcagattccctgccattataagaggtgtacctgttcctactgcaaagtgg
acaaccgatgggagtgagattaaaacagatgaacactacacagttgaaactgacaacttc
tcatcagtacttactattaagaactgcttaaggagagacactggggaatatcagatcaca
gtttccaatgcagctggcagcagaacagtagctgtacatcttactgttcttgatgttccc
ggtccaccaacaggtcctattgatattctggatgttacccctgaacatatgactatctca
tggaagccacctaaagacgatggaggaagccctgtgataaattatattgttgagaaacaa
gatacaaggaaagatacatggggtgttgtctcttcaggaagcattaagatgaagctgaag
gtcccacatctgcaaaagggttgtgaatatgttttccgagtaagagcagagaataagatg
ggtgttggccctccccttgactccatacctactgttgctaagcataaatttaatcctccg
tctcctcctggtaaaccagtggtaactgacatcactgaaaatgccgcaacagtgtcctgg
actctgccaaaatctgatggtggcagtccaataactggttactatgtagaacgtcgagaa
ataactggcaaatgggtgagggtcaacaaaacacctatagctgacctgaagtttagagtg
actggactctatgaaggaaatacatatgagtttagagtttttgctgaaaatcttgcagga
ctaagcaatccatccccaagttctgacccaataaaagcatgccggcccatcaagccacct
ggaccacctattaatcctaaactgaaagacaagaccaaagaatcagctgacttggtgtgg
acaaagcctctcagtgatggtggtagccccattctaggctatgtagtggaatgtcagaaa
gctggtacagcccagtggaacaggattaacaaagatgaactcattaggcaatgtgctttc
agggtacctggactaattgaaggaaatgagtacagattccgtataaaggcagctaatatt
gtgggagagggagagccaagagagctagcagaatctgtgattgcaaaagacatacttcat
cctccagaagtagaacttgatgttacttgtcgtgatgttattaccgttagagtggggcaa
actatccgcattcttgcccgagtcaaaggcagacccgaaccagacataacttggtctaaa
gaaggcaaagtattggtccaagaaaagcgagttgacataattcgtgatctacctcgtgtg
gagttacaaattaaagaagcaattagagctgatcatggcaagtatatcatctcagctaag
aacagctgtggacatgcccaaggttccgctatagttaacgtccttgacagacctgggcct
tgccagaacttaaaggttagcaatgtaaccaaagagaattgtacaattgcttgggaaaac
ccactagataacggtggctcagagataacaaatttcatagtggaatatcgcaaaccaaac
cagaaaggctggtcgattgttgcttcaaatgtcactaggcgattaatcaaggccaacctg
ttagccaatgatgaatactatttccgagtctgtgcagagaataaagtaggtgttgggcca
accattgaaacaaaaactccaattctggctattaaccctattgatagaccaggtgagcct
gaaaacctccatattgcagataaaggaaagacatttgtctacctaaaatggcggcggcct
gattatgatggtggcagcccaaatctatcatatcatgtagaaaggaggctgaagggttct
gctgactgggaaagagtacataaaggaagcattaaggaaacacactacatggttgacaaa
tgtgttgaaaaccagatttatgagttcagagtacaaacaaagaatgaaggtggagaaagt
gactgggtaaagacagaggaagttgttgtgaaagaagatttacagaaaccagtacttgat
ctgaaattaagtggtgtgctaactgtcaaggcaggggagaccattagacttgaggcaggt
gttagaggcaaaccatttccagaagtttcatggaccaaggacaaagacgctacagattta
acaagatcaccaagggtcaagattgataccagtgctgattcatctaaattttctcttact
aaagcaaagcgaagtgatggtggtaaatatgtaattacagcaactaatacagctggcagt
tttgtggcctatgccactgtcaatgttttagataagcctggccctgtaagaaatctgaaa
atttctgatgtgtccagtgataggtgtactattcgctgggatccaccagaagatgatggc
ggctgtgaaatccaaaattatattctagaaaaatgtgagagcaagcgaatggtttggtct
acctattctgctaatgtcttaacgcctggtaccacagtaacacgtctcatagaaggaaat
gaatatattttcagagtccgtgcagaaaataaaataggcacagggcctcccacagaaagc
aaaccagtcattgcaaaaaccaaatttgatagacctggtcgccctgaccccccagatgtc
actaaagtaagcaaagaagagatgactgtggtttggaatccacctgaatatgatggtgga
aagtccatcacaggatactttttggagaagaaggaaaaacattcaatacgatgggtccct
gttaacaagagtgcaatccctgagagacgtttgaaagtacagaacctcttcccaggacat
gaatatcagttccgtgtcaaggcagaaaatgaagttggaattggagaaccatctttgcca
tcaagaccagtggtggcaaaagaccccatagaaccacctggtccaccaaccaatctcaaa
gtggttgatacaaccaaaagttctataactcttggatggggaaaaccagtgtatgatggt
ggttcaccaataattggatatgttgtggaaatgagaccaaagaaaccagatacatcacct
gatgaaggctggaaaaggtgcaatgctgcagcacaacttgttcgcatggaattcactgtg
accagcttggacgaaaaccaggaatatgagttcagggtgtgtgcccaaaaccaagttggc
atcgggcgccctgcagaactaaaagatgctattaaacctaaagaaatcctagagcctccg
gagattgatttagatgccagcatgagaaaactggtcacggtgagagcaggatgccccatt
cgactatttgccatagtgagagggcgaccagcccctaaagtcacctggcgaagagtgggt
attgataatgtggtcagaaaaggacaagtcgatctggttgatactatggccttccttgtc
atccccaattctactcgtgatgactcaggaaaatattctttgacacttgtgaacccagct
ggagagaaagccgtgtttgtgaatgtcagagttttagacactcctggacctgtatctgat
ttaaaagcttcggatgtcactaaaacatcatgccacatttcctgggcccctcctgagaat
gatggtgggagtcaagtgacacattatattgtggagaaacgtgaggcagagagaaagacg
tggtcaacagttaacccagaagttaagaaaacgagcttccaagtcaccaatcttgtccct
gggaatgagtattatttcagagtaactgctgtcaatgagtatggtcccggcgttccaaca
gatgtccccaaaccagtgcttgcatcagatcctctgagtgagccagatcccccaaggaaa
ctagaagttactgaaatgacaaagaacagtgctacactagcctggttacctcccctgcgt
gacggaggtgctaaaattgatggctacatcattagttacagagaggaagagcagcctgca
gatcgctggacagagtactcagtggtaaaagatctcagccttattgtcactggcctaaag
gaaggaaagaaatacaaatttagagtagcggccagaaatgctgttggagtcagtttgcca
agagaagccgaaggagtgtatgaggccaaagaacagctcttgccaccaaagatccttatg
ccagagcaaattactattaaagctggcaagaaactacgaatcgaagcccatgtgtatgga
aagcctcacccaatctgtaaatggaaaaaaggagaagatgaagttgtcacatctagccac
ctggcagtgcacaaagcagacagttcttcaattctgatcataaaagatgttactaggaaa
gatagtggttactatagcctcactgcggaaaacagttctgggacagatactcagaaaatc
aaagttatcgtcatggatgctcctggaccccctcagcctccgtttgacatttctgacata
gacgccgatgcttgctccctgtcatggcacatccctctggaggatggaggcagtaacatc
accaattacatagtggagaagtgtgatgtaagccgaggtgattgggtgacagctctagct
tcagtgacaaaaacttcctgcagaattggaaaactgattccaggccaggaatatatcttc
cgggtccgtgctgaaaatcgatttggcatttcagagcctctcacatctccaaagatgctg
gctaagttcccatttgatgttcctagtgaaccaaagaatgcacgagtcactaaagtcaac
aaagactgcatatttgtggcatgggacagaccagacagcgatggagggagccccattact
ggatacctgatcgaacgcaaagaaagaaacagtttgctttgggtgaaagctaatgatact
cctgtccgatcaactgaatatccttgtgctggccttgtagaaggtcttgagtattcattc
agaatctatgccttaaacaaagctggatccagcccacccagcaaaccaacagaatatgta
actgcaagaacaccagttgatcctcctggaaagcctgaagttattgatgtttccaagagt
actgtatcccttatttgggctcgtccaaagcatgatggaggcagcaaaattattggctat
ttcgtagaagcttgcaaacttcctggtgataaatgggtacggtgcaatactacccctcac
cagattccccaggaagagtatacagctactggcttagaagagaatgctcaatatcaattt
agagcaattgccaagaccgcgataaacattagccagccttctgaaccttctgatccagtg
accattatcgcagaaaatgttccacccagaatagacctgagcttggctatgaaatcttta
cttaccgtgaaagctggaacaaatgtttgcttggatgctactgtttttggtaaaccaaca
ccaacaatctcttggaagaaagatggcacactgctaaaaccagcagaaggcataaaaatg
gccatgaaacggaacctgtgcaccctggagctgttcagcgtgaagcgaaatgactcagga
gactataccattactgccgaaaactcaagtggttccaaatcagccaccattaaacttaaa
gtgctagataaaccaggtcctccagcatctgttaaaattaacaaaatgtattcagatcgt
gcaatgctttcttgggaacctcctcttgaagatggaggctcagaaatcaccaattatatt
gttgacaaacgtgaaacgagcagacccaactgggcgcaagtctctgctactgtgcccatc
accagctgcagtgtagagaaacttatagagggccacgagtatcagttccgaatttgtgct
gaaaataaatacggagtgggtgatccaatctttactgaaccagcaattgctaaaaaccca
tatgacccaccgggacgctgtgatcctcctgttattagcaacataaccagagatcatatg
acagtaagctggaaaccaccagcagatgatggtggttcacccatcactggctatttggtt
gaaaagcgggaaacccaggcagttaactggactaaggtcaacagaaaacctgttatagaa
agaactataaaagccacaggtctccaagaaggcaccgaatatgagtttcgggttacagct
ataaataaggccggaccgggcaaacccagtgatgcatccaaagctgcttatgcccgggac
cctcagtatcctcctggcccaccagcttttcctaaagtatatgatacaacccgtagctcc
gtgagtatatcttggggcaagccagcctatgatggtggtagtcctatcatcggttacctt
gttgaagtaaaacgagctgactctgttaactgggtgaggtgcaatttaccagagaagcta
cagaaaacccgctttgaagttactggcctgatggaaaacacagaatatcagttccgtgtg
tatgccgttaataagatcggatacagtgaccccagtgatgtgccagacaaccactgtccc
aaggacatcttaattccacctgagggagaacttgatgctgatttgaggaagacactcata
ttacgtgctggagttacactgagactatatgtaccagtaaaaggacgtccacctccaaag
ataacttggtctaagccaaatgtcaatctgagagaaaggattggactggacataaagtca
actgactttgacactttcttgcgctgtgaaaacgtgaacaaatatgatgcaggaaaatat
atcttgactctggagaacagctgtggtaaaaaggaatataccatcgtagtgaaagtgctg
gatacccctgggccacctgtcaatgtaactgttaaggaaatatccaaagattctgcttat
attacctgggatcctcccattattgatggtggaagccctgtcataaattatgtggtagaa
aaacgtgatgcagagagaaagtcctggtctacagtggcaactgaatgtccaaaaacaagc
tttagagtatctaacttggaggagggaaaatcctacttcttcagggtgtttgctgaaaat
gagtacggcattggagatcctggtgagacacgtgatgccgtcaaagcttccgaaacccct
ggaccagttgtagacctgaaagtgttgtctgtaactaagtcatcttgtagcataggctgg
aaaaagccacgcagcgatggcggaagtcgaattaccggatatgtagttgatttcttgacg
gaagaaaacaagtggcaacgagttatgaaatcattaaacttacagtactccacaaaagac
ctgactgaagggaaggaatataccttcagagtgagtgctgagaatgaaaatggagaggga
accccaagcgaaatcactgttgtggcaaaggatgatgttgtggctcctgacctcgactta
aaggatctacctgatttgtgctacttggccaaagaaaacagcaacttccgtcttaagatc
cccataaaaggcaagccagctccatcagtatcctggaagaaaggggaagatcctctagtg
acagacagaagaatcagtgttgagtcatctgcagttaacacaactcttgcagtatatgat
tgccaaaaatcggatgctggaaaatacacaatcacactaaagaacgttgctggcactaaa
gaaggaactctctctataaaagttgttggcaagcctggcatccccactggaccaatcaaa
tttgatgaagtcacagcagaagccataaccttaaagtggggtcctccaaaggatgacgga
ggttctgaaatcaccaattatatcctagagaagagagattctgtaaacaacaagtgggtg
acatgtgcctcagctgtccagaaaaccacctttagagtaactagacttcatgagggtatg
gagtacaccttcagggtcagtgctgaaaataaatatggcgtaggagagggcttgaaatca
gagccaattgttgctaagcatccatttgatgtgcctgatgctcccccacctcctaacatt
gtggatgtcagacatgattcagtatccctaacttggactgaccccaggaaaacaggtggc
tctccaattacagggtatcatatcgagttcaaggaaagaaatagccttatgtggaagaga
gctaacaagactcctattaggatgaaagagttcagagtgacaggattaactgaaggtctt
gaatatgaattccgagttatggcaatcaatttagcaggagtaggcaagccaagcctgcca
tcagagccagttgtggcacttgatccaatagatcctcctggcaaacctgaggttattaat
gtaacaaggaattcagtgactctcatttggactgaacccaaatacgatggtggtcataag
ttgactggatacatagtggagaagcgagatctaccctctaaatcttggatgaaagccaac
catgttaatgtcccagattgtgcctttactgtaactgaccttattgaaggtggaaaatat
gaattcagaattagagcaaagaacacagcaggtgctatcagtgctccatctgaaagtaca
ggaaccattatttgcaaggatgaatacgaggcaccaaccatcgtccttgatcccacaata
aaagatgggctaacagtcaaagcagaagataccattgttttgagtgccattagcattctt
ggcaaaccccttccaaaatcaagttggtccaaggcaggaaaagacattagaccatcagat
gtcgttcagataacttccaccccaacatcttccatgcttactatcaagtatgccactaga
aaagatgctggtgaatacaccatcactgctaccaatccttttggcacgaaggaggaacat
gtgaaggtaacagttctcgatgtacctggtcccccaggtcccattgaaatcagtaatgtt
tctgctgaaaaagcaacacttacatggacacctcccttggaagatggtggctcaccaatt
aagtcctatgttcttgagaagagagaaactagtcgactcttgtggacagtggttgctgaa
gatattcagtcttgtaggcatgtggcaaccaaacttatccaaggaaatgagtacctcttc
cgggtctcagctgtcaatcaatatggcaaaggagaacctgtacagtctgcacctgtcaaa
atggtagacagatttggtccccctggccctcctggaaaaccagaagtatcaaatgtcact
aagaacactgccactgtcagttggaaaaggccaaccgatgatggtggcagtgagatcaca
ggatatcatgtagaaaggagagaaaagaaaggcttgagatgggtgagagcaacaaagatg
cctgtttctgacctcagatgcaaagtaacaggactgcaagaaggaaactcttatgaattc
cgtgtcagtgcagaaaacagagcaggaattggcccacctagtgatgcttcgaatcttgtt
ctaatgaaagatgtggcatatcctccaggaccaccttcaaatgcacgagtcactgatact
accaagaaatctgcgtctttagcatggggcaagcctcattatgatggtggacttgaaatc
actggctatgtcgtagagcatcaaaaagtaggagatgaggactggataaaagatacaaca
ggaaccgccctcagaatcactgagtttgttgtccctgatcttcagactaaagaaaaatac
aattttagaatcagtgccatcaatgatgcaggtgttggggagccagcagtgattccaaat
gttgaaatcgtagaaagggaaatggctcctgattttgaactagatgctgagcttcaaaga
acacttgttgttagagcaggactcagtattagaatatttgtgccaattaaaggtcgtcct
gctcctgaagttacatggaccaaagatgatatcaaccttaaaaacagagctaacatcgaa
aatacagaatcatttacacttcttattatcccagaatgtaacagatatgacacaggtaaa
tttgtgatgactattgaaaaccctgctgggaagaaaagtggctttgtcaatgtcagagtc
ttggatacaccaggacccgtccttaacctgaggcctactgacgtcacaaaggacagtgtc
accctgcactgggacctccctctgatagatgggggctcacgtataacaaactatattgtg
gagaaacgagaagcaacacggaaatcttacaccacagccaccactaagtgccataaatgc
acatataaagtcactggcttgactgaaggatgtgaatatttcttcagagtaatggcagaa
aatgaatatggaatcggtgagccaacagaaacaacagaacctgtaaaagcctctgaagca
ccattaccaccagacagtctgaacattatggatataactaagagcacagtcagcctggca
tggcctaaaccgaaacacgatggtggcagtaagatcaccggctatgtgattgaagcccaa
aggaaaggctctgaccagtggacccacatcacaaccgtgaagggcttagaatgtgttgtg
aagaatctaactgaaggggaagaatacaccttccaagtgatggcagtgaacagtgcaggg
agaagtgcccctagagaaagcagacccgtcgttgtcaaggagcagaccatgctaccagaa
ttggatctccgtggcatttatcagaaattagtcattgccagagctggtgacaacatcaaa
gttgaaattccagtgcttggtcgaccaaagcccacagttacatggaaaaaaggagaacaa
attcttaaacagacacagagagttaattttgaaaatacagcaacttcgaccatcttaaat
atcaatgaatgtgtaagaagtgatagtgggccatatccattaacagcaaggaacattgta
ggagaggtcggtgatgtcatcactgttcaagtccatgatatcccaggaccacctactgga
ccaatcaaatttgatgaagtgtcatccgattttgtaaccttctcttgggagccacccgag
aatgatggaggtgtaccaattagcaactatgtagtagaaatgcgacagaccgacagtact
acatgggtggagttggcaaccactgttatacgcactacctataaagccactcgccttacc
accggaatggagtatcaattccgggtaaaagctcaaaatagatatggagttggaccaggc
atcacatcagcatctgtagttgccaactatccatttaaggttcctgggcctcctggtacc
cctcaggtaaccgcagttaccaaggattcaatgacaattagctggcatgaacctctttct
gatggtggaagccccattttaggatatcatattgaaaggaaagaacgaaatggtattctc
tggcagactgtgagcaaagcattagtaccaggcaacattttcaaatcaagtggacttaca
gatggtattgcttatgaattccgagtaattgcagaaaacatggcaggcaaaagcaagccg
agcaaaccttctgaacctgtgtttgctttggatcccattgacccacctgggaaaccaatt
cctctaaatattactagacacacagttacacttaaatgggctaagcccgaatatactgga
ggctttaaaattactagttatatagttgaaaagagagaccttcctaatggacggtggctg
aaggccaacttcagcaacattttggagaatgaatttacagtcagtggcctaacagaagat
gctgcatatgaatttcgtgtgattgccaaaaatgctgctggtgctcttagtccaccatct
gagccatcagatgctatcacatgccgagatgacattgaagcaccaaggataatggtggat
gttaaatttaaggacacagttatactaaaagcaggtgaaacattcaagctggaagctgat
gtttcaggtcgcccacctcccacaatggaatgggccaaagatggaaaagagcttgaaggc
acaggaaaattagaaataaaaattgcagatttctctactaacctggtaaacaaggattca
tcaagaagggatagtggtgcctatacccttacagcaactaatcctggtggttttgccaaa
cacattttcaatgtcaaggttctggatagaccaggtccacccgaaggacctttagctgta
tcagaagtgacttcagaaaaatgtgtactgtcgtggttgcctccactggacgatggaggt
gctaaaattgaccattatatagttcagaaacgtgaaaccagcagattggcatggacaaat
gtagcctcagaagtccaagtaacaaaactaaaggtcactaaacttttgaaaggcaatgaa
tacatattccgtgtcatggcagtaaataaatatggagttggagagccactagaatcagag
cctgtgcttgcagtaaacccttatgggccccctgatccacccaaaaaccctgaagttaca
actattactaaagattcaatggttgtctgctggggacatcctgactctgatggtggaagt
gaaatcatcaattatattgtggaacggcgtgataaagctgggcaacgctgggtgaaatgc
aacaaaaaaactgttactgatttaagatttaaagtgtctggactgacggaaggacatgaa
tatgagttcaggattatggctgaaaacgctgctggaattagtgcaccaagtcctaccagt
ccattttataaggcttgtgatgctgtgtttaaacccggccctccaggtaacccacgcgtt
ctggatacaagcagatcatccatttcaattgcttggaataaacctatctatgatggtggt
tcagaaatcactgggtatatggttgagattgcccttccagaggaagatgaatggcagatt
gtcactccaccagctgggctcaaggcaacttcttacaccatcaccaatctcatagagaat
caagaatataaaatccgcatctatgccatgaattctgaaggaattggggaacctgcactt
gttcctggaactccaaaggccgaagacaggatgctgcctccagagattgaactggatgct
gacttgcgcaaagttgttactataagagcttgttgtaccctgagactttttgttccaatc
aaaggaaggcctgcacctgaggtgaagtggacccgggaacatggagaatctttagataaa
gctagcattgaatctacgagctcttataccctgcttattgttggaaatgtaaacagattt
gacagtggtaaatacatactaactgtagaaaacagctcaggcagcaaatctgcattcgtc
aatgtcagagtactagatacaccaggccctccacaggatctgaaggtaaaggaagtcact
aagacttccgtcacattgacatgggagcctcctctccttgatggaggttcaaaaataaag
aactatattgttgaaaagcgagaatcaacaagaaaagcatattcaactgttgcaacaaat
tgccacaagacttcctggaaggtagaccagcttcaagaaggctgtagttactatttcagg
gttcttgctgaaaatgaatatggcatcgggctgcctgctgaaactgcagaatctgtgaaa
gcatcagaacgacctcttcctccaggaaaaataactttggtggatgtcacgagaaatagc
gtgtcactttcttgggagaaacctgagcatgatggaggcagccgaattctaggctacatt
gtagagatgcagagcaaaggcagtgacaaatgggccacgtgtgccacagtcaaagtcact
gaagccactataactggattaattcagggtgaagaatactcttttcgtgtctcggctcag
aacgaaaagggcatcagtgatcctagacaactgagtgtgcctgtaattgccaaagatctt
gtcattccaccagccttcaaactcctattcaatactttcactgtgctggcaggtgaagac
ctaaaagttgatgttccattcattggacgccctacaccagctgtaacctggcataaagat
gatgtaccactgaagcagacaactagagtaaatgcagagagcacggaaagtaattcaata
ttgacaataaaggaagcctgccgagaagatgtgggacattacacagttaaactgactaac
tcagctggtgaagctactgaaacccttaatgttattgttcttgacaaacccgggcctcca
actggaccagttaaagtggatgaagtgacagctgatagtattactctttcctggggccca
cctaagtatgatggtggaagttctatcaataattacattgtagaaaaacgggacacttcc
acaaccacttggcaaattgtgtcagctactgttgcaaggacaacaataaaagcttgcaga
ttaaagactgggtgtgaatatcagtttaggattgcagcggaaaacagatatggaaagagt
acctacctcaattcagagcctattgtagcccagtatccattcaaagttcctggtcctcct
ggaacaccatttgtaacactctccaccaaggacagcatggaagtacgatggaatgagcca
gttagtgatggaggtagcaaaatcattggctatcatctagaacgcaaggaaagaaataac
atcctctggcttaagttgaataaaacacctattcctcaaaccaagtttaaaacaactggc
cttgatgaaggcattgaatatgaatttagagtctctgcagagaacattgtaggcattggc
aagccaagtaaagtgtcagaatgctatgtagctcgtgacccatgtgatccaccagggcgg
ccagaggcaatcattgtcacacggaattctgtgactcttcagtggaagaaacccacttat
gatggtggaagcaagatcactggttatattgttgagaaaaaagaattgcccgagggccgt
tggatgaaagccagttttacaaatgtcattgacactcagtttgaagtaactggcctagtg
gaagatcatagatacgagttccgggttatagctcgaaatgctgcaggagtgttgagtgag
ccttcagaaagcacaggagcaataacagcaagagacgaggtagatccaccacgaataagt
atggatcccaagtacaaagacacaattgtggttcatgctggtgaatctttcaagattgat
gcagatatttacggcaaaccaataccaaccattgaatggttaaaaggtgataaagagctt
tcaaatacagctagattagaaataaagagcactgactttgccaccagtctcagtgtaaag
gatgcagtacgcgttgacagtggaaattacatattgaaagccaaaaatgttgcaggagag
agatcagtcactgtaaatgtcaaagttctcgataaaccaggcccacctgaaggacctgtt
gttataacaggagttacagcagagaaatgcacactagcttggaaacccccactacaggac
ggtgggagtgatatcataaattatattgtcgaaaggagagaaaccagccgcttagtttgg
actgtggttgatgccaatgtgcagactctcagctgcaaggttactaagcttcttgaaggc
aatgaatatattttccgtataatggccgtaaacaaatatggtgttggcgaacctcttgaa
tctgaaccagtaattgccaagaatccattcgtagtaccagatgcaccaaaggctccagaa
atcacaacagtgaccaaggactcaatgattgttgtctgggaaaggccagcgtctgatggt
ggcagtgaaattcttggatatgttcttgaaaaacgggacaaagagggtattagatggaca
agatgccacaaacgtctgattggggaattgcgcttgagagtaactggactcatagaaaat
cacaattatgaattcagagtctctgctgagaatgctgctggacttagtgaaccaagcccc
ccttctgcttaccaaaaggcttgtgatcctatttataaaccaggacctccaaacaatccc
aaagtcatggatattaccagatcttctgtcttcctttcttggagcaaaccaatatatgat
ggtggctgtgaaatccaaggatacattgttgaaaaatgtgatgtgagtgttggtgaatgg
acaatgtgcactccaccgactggaatcaataaaacaaatattgaggtagagaagctgtta
gaaaagcacgaatacaacttccgtatctgtgctattaataaagctggagttggagaacat
gctgatgtccctggacctattatagtagaagaaaaattggaagcaccagacattgatctt
gacctagaactaaggaaaattataaatataagggcaggtggctccttaaggttgttcgtt
cctattaaaggtcgtcctaccccagaagttaaatgggggaagatggacggtgaaatccga
gatgcagctataatcgatgtcactagcagtttcacctctcttgttcttgataatgtcaac
cgatatgacagtggaaaatatactctcacattagaaaacagcagtggaacaaagtctgcc
tttgttactgtcagagtcctggatacaccaagtccgcctgttaacctgaaagtcacagaa
atcactaaagagtcagtatcaatcacatgggaacctcctttgttggatgggggatccaaa
atcaaaaattacattgttgagaaacgtgaagccacaagaaaagcatatgctgcagttgtg
acaaattgccataagaattcttggaaaatcgatcaactccaagaaggttgcagttattac
tttagagttacagctgaaaatgagtatggtattggccttcctgcccgcactgctgatcca
attaaggttgcagaagtcccacaacctccaggaaaaataactgtggatgacgtcaccaga
aacagtgtctccttgagttggacaaagcctgaacatgacggtggcagtaaaatcattcag
tatattgtggaaatgcaagctaaaaacagtgagaaatggtcagagtgtgctcgagtcaag
tcccttgaagcagtaattaccaacctaactcagggagaagaatatctttttagagttatt
gctgtaaatgaaaaggggagaagtgatcctaggtcccttgcagttccaatagttgccaaa
gatctggtcattgagccagatgtaagacctgcgttcaacaattatagtgtacaggttgga
caagacttgaaaatagaagtgccaatttctggacgtcctaagccaaccattacctggact
aaggatggtcttccactgaagcagactacaagaatcaatgttaccgattcacctgacctc
actgtactcactattaaagaagctcataaggatgatggtggacattatggaatcacagtt
gctaatgttgttggtcagaaaacagcatccattgaaattataactctagataaacctgat
cctccccaaggacctgttaaatttgatgaagtcagtgctgaaagtattacattatcatgg
aaccctccattatatactgggggctgccagatcaccaactacattgttcagaaaagagat
acaaccactaccatatgggatattgtttctgctactgttgccagaactacactcaaagtg
accaaactgaaaactggtacagaataccaattcagaatatttgctgaaaacagatatgga
caaagctttgccttggagtccaatccgattgtagctcaatatccctacaaagtgccaggc
cctccaggcacaccatttgtcacagccatttccaaggactccatggtggttcagtggcat
gaaccaatcaataacggtggaagcccagttataggttaccaccttgaaagaaaggaaaga
aatagtattttgtggacgaaagtcaacaaaactattattcatgacacccagtttaaagta
gtcaatcttgaagaaggcattgagtatgaattcaaagtttatgctgaaaatattgttggt
gtaggcaaagcaagcaagaattctgaatgctatatagccagagatccctgtgacccacca
ggaaccccagaagcaataatagttaaaagaaatgaaatcactttacaatggaccaaacct
gcctacgatggtggaagtatgattacaggttacattgtagagaaacgtgatttgcctgag
ggtcgttggatgaaagccagtttcacaaatgtcattgaaactcagtttactgtgtcaggt
cttactgaagatcaaagatatgaattcagagtcattgcaaagaatgcagctggtacaata
agtaaaccctctgacagtactggaccaataactgccaaggatgaggttgaactcccaaga
atttcaatggatccaaaattcagagacacaattgtggtaaatgcaggcgaaacattcaga
cttgaggctgatgtccatggaaagcccctacctaccattgaatggttaagaggagataaa
gaagttgaggaatctgctagatgtgaaataaagaacacggatttcaaggctttacttatt
gtaaaggatgccattagaattgatggtggacagtatattttgagagcttccaatgttgca
ggttctaagtcattcccagtaaatgtaaaagtattggacagaccaggaccgccagaaggg
ccagtccaggttaccggagtcacttctgaaaaatgcactttaacatggtctccaccacta
caagatggtggcagtgatatttctcactatgttgttgaaaagagagaaacaagtcgactt
gcctggactgttgttgcttcagaagttgtgaccaattctctgaaagttaccaaactctta
gaaggaaatgaatatattttccgtataatggctgtcaacaaatacggtgttggagaacct
ttggaatctgcaccagtgttaatgaaaaatccctttgtgcttcctggaccaccaaaaagc
ttggaagtcacaaacattgccaaggactccatgactgtctgttggaaccgtccagatagt
gatggcggaagtgagattattggctacattgtagaaaaaagagacagaagtggcattagg
tggataaaatgtaataaacgccgcattacagatttgcggctaagagtaacaggattgaca
gaagatcatgagtatgaatttagagtctctgcagaaaatgctgctggagttggagaacca
agtccagctacagtttattataaggcttgcgatcctgtgttcaaacctggcccacccacc
aatgcgcacattatagacaccactaaaaattcaattacacttgcctggggtaaacccatc
tatgatggtggcagtgagattcttggatatgtaatagaaatctgtaaagcagatgaagaa
gaatggcaaatagttactccaccaactggccttaaagtcactcgctttgaaatttcaaaa
ctaattgaacaccaagagtataaaatacgagtctgtgccctcaataaagttggtttaggt
gaggctacatccgttcctggtactgtgaaaccagaagataaactcgaagcacccgaactt
gaccttgattctgaattaaggaaaggaattgttgtaagagctggtggatctgccagaatt
cacattccgttcaaaggccgtccaacacctgagattacttggtctcgagaggaaggtgaa
ttcacagataaggtccaaattgaaaagggagtaaactatacccaactatcaatagataac
tgtgatagaaatgatgctggaaaatatattctgaagctggaaaacagcagtggttctaaa
tctgcttttgtaacagtgaaagtacttgacaccccaggaccaccacagaacttggcagtc
aaagaagtgaaaaaggattctgtcattctggtatgggaaccgcccatcatcgatgggggt
gcaaagatcaagaactatgttatcgacaaacgtgagtcaaccagaaaagcatatgctaat
gtgagtaataaatgcaacaaaacaagctttaaagttgagaatcttacagaaggagctatt
tattattttagagttatggctgaaaatgaatttggagttggcgttccagtggaaactgtt
gatgctgtgaaagctgctgaacctccttctccgccaggaaaggttacactcactgatgtg
tcccagaccagtgcatcgcttatgtgggagaaacctgaacatgatggtggtagcagagtc
ctggggtatgttgtggaaatgcagccaaaaggaacggaaaaatggagtgttgtggctgaa
tctaaagtctgtaatgcagttgtaactggcttgagttctggacaagagtatcagttccgt
gtcaaagcttacaacgagaaaggaaaaagcgatccaagagtgcttggtgttcctgtcata
gccaaggacttgactatacagcctagtcttaagttgccatttaacacatatagtgtccaa
gctggagaagatcttaaaattgaaattctagttattggaagaccgagacccaaaatttca
tgggtcaaagatggtgagccttttaaacagacaacaagagtaaatattgaggaaacagct
acttcagctattttgcacattaaagaaagtaacaaagatgactttggaaaatacaccata
acagcaacaaatagtgcaggtacagcaacagaaagtcttagtattattgttttagaaaag
cctggacctccagttggaccagttcggtttgatgaagttagtgcggactttgtggtcata
tcttgggaacctccagcctatactggtggttgccagataagtaactacattgtagagaag
cgagatacaaccaccaccacttggcagatggtatcagcaacagttgcaaggacaacaatt
aaaataaccaaattgaaaacaggcgcagagtaccagtttagaatttttgcagaaaacaga
tatggaaaaagtgcccccctggattctaaatcagttattgtacaatatccatttaaagta
cctggaccacctgggactccttttgtgacatcgatctcaaaagatcaaatgcttgttcaa
tggcatgagccagttaatgatggaggtagcagagttattggctaccatcttgaacagaaa
gaaaagaacagcattttatggatcaaattaaacaagactcctattcaagatactaaattc
aaaacaactgggcttgatgaaggccttgagtatgaattcaaagtttctgctgaaaatatt
gttggcatcggcaagcctagcaaagtgtcggaatgttttgttgctcgtgatccatgtgac
ccacctggtcgcccagaagccattgttattacaagaaacagtgtcactctgaaatggaag
aaacctgcctatgatggtggtagcaaaataacaggttatattgtggaaaagaaagatcta
cctgatggtcgttggatgaaagccagctttaccaatgtgttagatactgaatttacagtg
agtggacttgtagaagaccaaagatatgaatttagagtaattgcaagaaatgcagctggc
aactttagtgaaccatctgaaagcactggtgccattactgcaagagatgaaattgatgca
ccaaacgcctcactggatccaaaatataaagatgtcatcgttgttcacgcaggagagact
tttgtccttgaagctgatatccgtggcaaacctataccagatgttgtttggtcaaaagat
ggaaaagagcttgaagaaacagctgctaggatggaaatcaaatccactattcagaaaaca
actcttgtcgtcaaagactgtgtacgtactgatggaggacaatatattctgaaactaagc
aatgttggtggtacaaagtctataccaatcactgtgaaggtacttgacaggccagggcct
cctgaagggcctctgaaagtgtctggggttaccgccgaaaaatgttacttggcgtggaac
ccgcctttacaagatggtggtgctaatatttcacattacatcattgaaaagagagagaca
agcagactctcctggacccaggtttcaactgaggtacaggccctgaactacaaagtcact
aaacttcttcctggtaatgaatacattttccgtgtcatggctgtgaataaatatggcatt
ggagagcccttagaatctgagcctgttatagcctgtaatccttataaacccccaggtcct
ccttcaccacctgaagcctcagcaatctccaaagattctatggtagtaacatgggcacgc
ccagtggatgatggaggtgctgaaattgagggttacattcttgaaaaacgagacaaagaa
ggcattagatggaccaagtgcaacaagaaaacactaacagatctccgattcagggtaact
gggcttactgaaggtcattcctatgaatttagagtttctgctgaaaatgcagctggcgtg
ggtgaacccagtgagccatccgttttctatcgggcatgtgatgctttgtatccaccaggt
ccaccaagtaatccaaaagtgacagacacttccagatcttctgtctccctggcatggaat
aagccaatttacgatgggggtgcccctgttaagggctatgtcgttgaagtcaaagaagcc
actgatgatgaatggacaacttgcactccaccaacaggattacaaggaaagcagttcaca
gtaaccaagcttaaagaaaatactgaatataatttccgtatttgcgccatcaattctgaa
ggtgtaggtgaacctgcaactatacctggctctgttgttgctaaagaaaggctagagcca
ccagaaatagaacttgatgctgatctcagaaaggtggtcattctgcgtgcaagcgctact
ttgcgtttatttgtcaccattaaaggtcgaccagaacctgaagttaaatgggaaaaggct
gaaggcattctcactgaaagggcccagattgaggtgaccagctcatatacaatgttggta
attgataatgtgaccagatttgacagtggtcggtataatctgactctagaaaataacagt
ggctccaaaacagctttcgttaatgtcagagttcttgactcgccaagcgcccctgtgaat
ttgactgtaacggaagtgaagaaagactcagtgacattgtcttgggaaccaccgcttatc
gatggcggagctaaaattacaaactacatcgttgaaaaacgagaagctacaagaaaagca
tatgctactgttacgaacaattgtactaagaatacttttaaaattgaaaatctacaagaa
ggatgttcttactacttccgagtcttggcttccaatgaatacgggattggtttgccagcc
gaaataactgaacccgttaaagtttctgaaccacccctcccacctggaagagtaactctc
gttgacgtgactcgtagcacagctacaattaagtgggaaaaaccagaaagtgatggtggc
agcaaaattactggttatgtagttgaaatgcagactaaagggagtgaaaaatggagcact
tgcacacaagttaagactctagaagcaactatatctggcctaactacaggagaagagtat
atcttcagggtagctgcagttaatgaaaaaggaagaagtgatccaagacaacttggagtg
ccagtaattgcaagggatattgaaataaagccttctgttgagcttcctttcaatactttc
aatgtaaaggctacagaccaacttaagattgatgttccatttaaaggaagacctcaagct
actgtaagctggaaaaaagatggtcagactcttaaagaaacaactagagtcaatgtttct
tcttcgaagactgtaacatcactatctattaaggaagcttcaagggaagatgttggaacg
tatgaattatgtgtttcaaacagtgctggatccataacagttcctattacggtaattgtc
cttgacaaaccaggacctccaggacctatacagattgatgaggttagttgtgacaatata
accatttcttggaatcctccagaatacgatggtggctgccaaattagcaattacattgtc
gaaaagagagaaaccacttctacaacatggcacgtagtttcacaagcagttgcgagaaca
tccattaaaatagttcgtctgacaacaggaagtgagtatcagttccgtgtttgtgcagaa
aaccgctatggaaagagctcctacagtaactcttcagctgttgttgcagagtatccattc
agccccccaggtcctcctggtactcctaaagttgtgcatgctacaaaatctaccatgatt
gtaagctggcaagtgccagttaatgatggaggaagtcaagtaattggttatcacctcgaa
tataaagaaagaagcagcattctttggtcaaaagcaaataaagtcctcatccccaatact
caaatgaaagtctccggcctagatgaaggactgatgtatgagtatcgtgtatatgctgag
aatattgctggaattggtaaatgcagtaaatcttgtgacccagtccctgcacgagatcct
tgtgaccctcctggacaacccgaagtcacaaatatcacgagaaaatctgtgtcccttaaa
tggtctgcacctcgttatgatggtggagctaggatcacagggtacattatcgaacgtaga
gaactaccagatggccggtggctgaagtgcaattttactaacatacaagaaacatacttt
gaagtaactgaacttactgaagatcagcgttatgaattccgagtctttgcaaggaatgct
gctgactcagttagtgaaccatctgaatccactggacctattacagttaaagatgatgtt
gaggctccaagaattatgatggatgtcaagttccgagatgttattgttgtcaaagctgga
gaggtccttaagataaatgcagacattgcagggcgacctctgccagtagtttcctgggcc
aaggatggtgtagaaattgaagaaagagcaagaacagaaattgtctcgacagactatact
actttgttaacagtgaaagactgtgtcagacgagacactgggcagtatgtactcacactg
aagaatgttgctggaactcggtctatggcagttaattgcaaggtacttgataagcctggc
ccaccagcaggaccacttgaaataaatggcctcactgctgaaaaatgctctctttcctgg
ggcccgccccaagaagatggtggcgcaagtatcgactattacattgtagaaaaacgtgaa
acaagccgccttgcatggacaatatgtgaaggagagttaaggacaacatcctgtaaagta
accaagttgctcaaaggtaatgaatacatctttagagtaaccgccgttaataaatatggt
gttggcgagcccctggagagtgtggctgtaaaggcactagatccatttacagttccaagt
ccaccaacatctttggaaattacgtctgtgaccaaagagtctatgacactttgctggtca
agacctgagagcgatggtggcagtgagatctctggatatatcattgaaaggcgagagaaa
aacagcctacgatgggtgcgtgtaaacaaaaaaccagtttatgatttgagagtgaaatca
actggacttcgagaaggatgtgaatatgagtatcaagtttacgcagaaaatgctgctggc
ctaagccttccaagtgaaacctctcccctaattcgggcagaagatccagtgttcttacca
tctcctccatccaaaccacaaattgtggactcaggcaagacaaatataaccattagctgg
gttaagcccttatttgatggtggtgccccaataactggatacagtgtcgaatacaagaaa
tctgatgaaactgactgggaaactgccattcagagcttaagaggcacggaatatacaata
agtggactaacaactggagccgaatatgttttcagagtaagatctgtcaataaggtaggt
gctagtgatcccagtgatagttccgatccccagatagcaaaagaaagagaagaagaacct
gtgtttgatcttgacagtgaaatgaagaaaaccttgattgtcaaagccggtgcctcattt
accatgactgtacctttcagaggaagaccagtacccagtgtctcatggagtaagccagac
actgacctccgcactagagcttatattgattccacagactctcgaacatcacttactatt
gaaaatgccaacagaaatgattctggaaaatacacattaacaattcagaatagtctgaat
gctgcttcactgaccttagttgtcaaagttttagattctcctggtcctccagccaatatt
actgtacatgatgtcaccaaagagtctgctgtgttatcctgggatgttcctgaaaatgat
ggtggcgcaccagtgaagaactaccacatagaaaaacgtgaagccagtaagaaagcgtgg
gtctctgtgaccaacaactgcaaccgcctctcctacaaagttaccaacttacaagaaggg
gcaatttactacttcagagtctctggagaaaatgagtttggcgttggtgtgccagctgaa
acaaaggaaggagtaaaaataacagaaaaaccaagcccacctgaaaaacttggagtaaca
agtatatccaaagacagtgtttccctgacttggctgaagccagaacacgatggtggaagc
agaattgttcactatgtcattgaaacactagaaaaagggcagaaaaactgggttaaatgc
gccgtggtaaagtcaacccatcatgttgtttctggtctgagggagaattctgaatacttt
ttccgggtatttgctgaaaatcaagctggtctgagtgacccaagagagcttctgcttcct
gttcttattaaggagcagttagaaccacctgaaattgatatgaagaatttcccaagtcat
accgtatatgttagagctggttcaaaccttaaagttgacattccaatttctggaaaacca
ctgcccaaagtgaccttatcaagagatgatgttcctgtgaaagcaaccatgagatttaat
attgaagttactgcagagaacctgaccattaatctcaaagaaagtgttgccgctgattct
ggaaaatatgagatcactgctgccaactccagtggaacaaccaaagcatttattaacatc
attgtactggacaggcctggtcccccgactggccctgttgttattagtgatataactgaa
gaaagtgtgactctcaaatgggagccgccaaagtatgatggaggaagtcaggttaccaat
tacattgtactaaagagagagacaaatactgcagtatgggctgaagtgtctgcaacagtt
gcaagaactgtgattaaagtcatgaaactgaccaaaggagaagaataccaattccgcatc
aaggcagaaaaccgctttggtatcagcgatcacatagattcagcttatgtggttgtcaaa
ctaccatacacaacacctggtccaccatctacaccatgggtcactaatgttactcgagaa
agcatcaccgtgagctggcatgaaccagtatccaatggaggcagtgcagttacaggctat
cacctggaaatgaaagatagaaatagtatattatggcaaaaagtcaacaaaatggtcatc
cgcacaactcacttcaaagtcacaacaatcagtgctggacttatttatgaattcagagta
tatgcagaaaatgctgctggtgttggaaaacccagccatccttctgagccagtcctagcc
atagatgcctgtgaaccaccaagaaatgttcgtatcactgatatttcaaagaattctgtc
aatctttcatggcaacaaccagctttcgatggaggaagcagaattacaggctatatcgtt
gagagacgagaccttccagatggcagatggaccaaagccagcttcaccaatgttattgag
actgaattcactgtctctggcttgactcagaattcccagtatgaattccgtgtctttgct
agaaatgctgttggttccattagtaatccatctgaggttgtaggccccattacgtgcatc
gattcttatggtggacctgtaattgatttacctctagaatatacagaagttgtcaaatac
aaagcaggcacatctgtgaagctcagagctggcatctcaggcaaacctgagcctacaatt
gagtggtataaagatgataaagagttacaaaccaatgcactgttgtctatcgaaaatacc
actgaccttgcatctatactcatcaaagatgcaaatcgccttaatagtggaagctatgaa
ttaaaactgaggaatgccatgggctcagcctcagccaccatcagagtgcagatccttgac
aaaccaggacctccaggcggaccaattgaatttaagaccgtcactgctgaaaagataact
tttctctggcggcctccagcagatgatggtggtgcaaaaatcactcactacatcgtggaa
aagcgtgagacaagccgtgttgtgtggtctatggtgtctgaaaatttggaagagtgcatc
attaaaactaccaagattataaaaggaaacgaatacatcttccgggttcgagctgtgaac
aaatacggaattggcgattcactggaatctgatccagtggtagcaaagaatgcatttgtt
acaccagggcctccaagcataccagaggtgacaaagattaccaagaattcaatgactgtt
gtctggaacagaccagttgcagatggtggtagtgaaataagtggctatttccttgagaaa
cgagacaagaagagtctgggatggtttaaagtcctaaaggagactatccgtgacaccaga
gagaaagtgacggggctcacggaaaacagtgactatcaataccgagtttgtgctgttaat
gctgctggacagggtccatattctgaaccatctgacttctacaaagctgcagatcctatt
gatcctccaggcccaccggctaagataagaattgcagattcaactaaatcatccatcact
cttggctggagtaaacctgtctatgatgggggcagtgctgttactggatatgttgttgag
atgagacaaggagaagaagaggaatggactattgtctctacccaaggagaagtcagaacc
acagaatatgtagtatctaacctgacacctggagtcaattactacttccaggtgtctgct
gtaaactgtgctggtcaaggagaacctatagcaatgactgaacctgtacaagctaaagat
atacttgaggaaccagagatcgacctagatgtggctctcagaacatctattatagctaaa
gccggcgaagatgtacaaatattgattccttttaaaggcagacctccacctactgtcaca
tggagaaaagatgagaagaatcttggcagtgatgccagatacagcattcaaagcactgat
tcatcttcattactcattattcctcaagtaactcgtaatgatacaggaaaatatattctc
acaatagaaaatggagttggcgaaccaaagtcttcaactgtgaatgttaaagtgctcgat
acgccagctgcctgccagaaactacagattaaacatgtttctcaaggcacagtcactttg
ttctgggatcctcctctcattgatggaggatctcccataattaattatgtcattcaaaag
agagatgccaccaagagaacatggtctgcagtgtcacacaaatgctctaacacatccttt
aaggtaacagatttgtcagagaaaattccgttcttctttagagttcttgcagaaaatgaa
attggaattggggaaccgtgtgaaaccacagagcctgtgaaggctgccgaagtaccagct
cctatacgggacctctcagtgaaagattcaacaaagacatctgttatcctgagctggacc
aagcctgactttgatggtggtagtatcatcacagaatatgttgtagaaaggaaaggtaaa
ggagaacaaacgtggtcacatgcgggcataagtaagacatgtgaaattgaggttagccaa
cttaaagaacagtcagaactggaattcagagtgtccgccaaaaatgagaaaggactgagt
gatgctgtcactattgggccaattacagtaaaagaacttgtaattacacctgacgttgac
ctatcagaaatccctggggcacaagtcactgtgagaattgggcataatgtgcacctcgaa
ttaccttataaaggaaaacccaaaccatctatcagttggctgaaagatggtttgccattg
aaagaaagtgaatatgttcgtttcagtaaaactgaaaacaaaattattttggatattaag
aatgtcaagaaggagaatggaggaaaatacaccattattcttgataatgcagtttgtaga
aactcatttcccattacaatcatcacacttggcccgccatcaaagcccaaaggtcccatc
cgatttgatgaaatcaaagctgacagtgtcataatgtcatgggatgtgcctgaagatgat
ggaggaggagagattacctgttacagcatcgagaagcgggaagcttcacaaactaattgg
aagatggtgtgttcaagtgttgccaggacaactttcaaagttcctaatctagtcaaagac
tccgaataccaatttagagtaagggcagaaaacagatatggagtcagccagccacttgtc
tcaaacattattgtggcaaaacaccagttcaggattcctggccccccagggaagccagtt
atatacaatgtgacttctgatggcatgtcactaacttgggatgctccagtttataatggt
ggttcagaagtcactggattccatgttgaaaagaaagaaagaaatagcatcctctggcaa
aaagttaatacatcaccaatatctgggagagaatatagagctactggactaatagaaggc
ctggactaccagttccgtgtgtatgctgaaaattctgccggcctaagctcgcctagtgac
ccaagcaaatttaccttggctgtttccccagtagatccacctggcactcctgactacatt
gatgtcacccgagaaaccatcacacttaaatggaacccaccgttgcgtgatggaggcagt
aagattgtggcgtacagcattgagaaacgccaagggagtgatcgttggcttcgatgcaac
tttactgatgtcagtgaatgtcagtacacagttacaggacttagtcctggggatcgatac
gagttcagaataattgcaagaaatgctgttggaactataagcccaccctcacagtcttct
ggtattattatgacaagagacgaaaatgttccaccaatagtagagtttggccctgagtac
ttcgatggcctcattattaaggctggagagagcctcagaattaaagctttggtacaagga
cgaccagtacctcgagtaacttggttcaaagatgaagtagaaattgaaaagaggatgaat
atggaaataactgatgtccttggatccaccagcctctttgttagacatgctactcgggac
catcgcggtgtatataaagtggaagccaaaaatgtatctggctctgccaaagctgaaatt
acagtgaaagtgcaagataccccaggaaaagtagttgggccaataagattcacaaacatt
actggcgagaagatgaccctgtggtgggacgctccgctcaatgacggctgtgctcctgta
acccactacctcattgaaaaacgggaaaccagcagacttgcttgggcgctcattgaggat
aactgtgaagcccacagctataccgccactaaactgataactggcaatgaataccaattc
cgtgtttctgcagttaacaagtttggcgttggcagaccacttgattctgacccagtggtt
gctcaaatacaatacactatacctgatgcccctggcactccagaacctagtaatgtaaca
gggaatagcattaccctaacatggacaagaccagaatcagatggtggcaatgaaattcaa
cattatatccttgaaagaagagaaaagaaaagcacacgatgggtgaaagtgatcagcaaa
cgaccaatctcagagacaagattcaaagtcactggtttgatagagggcaatgagtatgaa
ttccgtgtcatggctgaaaatgctgcaggagtaggacctgccagtggtatctcgagatta
atcaaatgtagagagccagtcagcccaccaagtgctcccactgtggtcaaagtgacagac
acatcaaagacaactgtgagcttagaatggtctaagccagtgtttgatggaggcatggaa
ataattgggtatattattgaaatgtgcaaagctgacttgggagactggcacaaggtgaat
acagaggcatgtgtgaaaacaagatatacagtcacagatctacaagcaggtgaagaatac
aaattccgggttagtgctatcaatggtgctgggaaaggagacagctgtgaagtgactgga
acaattaaagcagttgaccgattaacagctcctgagctagacatcgatgcaaacttcaag
cagactcatgtcgttagagctggggccagtattcgccttttcattgcctaccaaggtaga
cctactcctacagctgtgtggagcaaacctgactctaaccttagcattcgggctgatatc
cataccacagactccttcagcaccctcactgtggaaaactgcaacagaaatgatgcaggg
aaatatacccttaccgtagaaaacaacagtggtagtaagtcaatcacattcaccgtaaag
gtgctagacactccaggcccacctggtccgattaccttcaaagatgtgacacggggatct
gtcacactgatgtgggatgcccctctccttgacgggggtgccagaatccatcactatgtg
gtagagaaacgagaagcaagtcgccgtagctggcaggttgtcagtgaaaaatgcactcgt
cagatcctcaaagtcaatgacctggcagaaggcgttccatactatttccgcgtttttgca
gaaaatgagtatggtgttggtgaaccctatgaaatgccagaaccattggtagctacagaa
cagcctgctccacctaggagacttgatgtcgttgatacaagcaaatcctctgcagtctta
gcttggcttaaacctgaccatgatggaggcagccgaatcactggctacctgctcgaaatg
agacaaaagggatctgacttctgggttgaagctggtcacaccaaactgcttactctcaca
gtggaacgcctggttgagaacacggaatacgaattccgggtgaaggccaagaatgatgct
ggttatagtgaacccagggaagccttctcttctgtcatcatcaaggaacctcaaattgag
cccactgctgatctcaccggaattactaatcagctcataacttgcaaagcaggaagtaca
ttcaccattgacgtgccaatcagtggccgtcctgcccccaaagtaacatggaagctggaa
gaaatgagactaaaggagacagatcgaatgcgtatcacaacaacaaaagacagaaccact
ttgtctgtaaaggacagcatgagaggtgattctggaagatacttcctgaccttagaaaat
acagctggtgttaaaacatttaccatcacagttgtagtcattggaaggccaggtccagta
actggccccatcgaggtctcatctgtctcggctgaatcatgtgtcctttcatgggctgaa
cctaaagacgatggaggcaccgacattactaattacatagttgaaaagcgtgagtcggga
acaacagcctggcagcttgtcaactccagtgtcaagcgcactcaaattaaagtcactcat
cttacaaaatacatggaatattctttccgtgtcagttcagagaacagatttggcgtcagc
aagcctctagaatcagcaccaataattgctgagcatccatttgtcccaccaagcgctcct
accagacctgaaatctaccacgtgtctgccaacaccatgtctattcgttgggaagaaccc
tatcatgatggtggcagtaaaatcattggctactgggttgagaagaaagaacgtaacacc
attctttgggtgaaagaaaacaaggtgccgtgcttagagtgcaactacaaagtgactggt
ttggtagaaggactggaatatcagttcagaacatatgcactcaatgccgcaggtgttagc
aaagccagtgaagcttcgagacctatgatggctcaaaacccagttgatgcaccaggaaga
ccagaggtgacagatgtcacaagatcaacagtgtcactgatttggtctgcgcccgtgtat
gatggaggcagcaaggttgtgggctacatcatagagcgtaagccagtcagtgaagttgga
gacggtcgctggctgaagtgcaactataccatcgtatctgacaatttcttcactgtgacc
gctctcagtgaaggagacacttatgaattccgtgtattggctaaaaatgcagcaggtgta
attagcaaaggatcagaatctacagggcccgtcacttgccgagatgaatatgctccaccc
aaagccgaactggatgccagattgcagggtgaactggttaccatcagagcaggctcagat
cttgttcttgatgctgcagttggtggcaaacctgaacccaaaattatctggaccaaaggg
gacaaggaactagatctctgtgaaaaagtctctttgcaatatacgggcaaacgagcaact
gctgtgattaagttctgtgacagaagtgacagtggaaaatatactttaacagtgaaaaat
gccagtgggaccaaggctgtgtctgtcgtggtcaaagttcttgattcccctggcccttgt
ggaaatctcactgtcagcagaataacagaagagaagtgcactttagcctggagccttcct
caggaagatggaggagcagaaatgactcactacattgtggagagacgtgagactagcagg
ctcaactgggtgattgttgaaggcgaatgcccaacactatcatatgtagttaccaaactc
attaagaacaatgaatacatattccgagtgcgagcagtaaacaaatatggccctggtgtg
cccgttgaatcacagccaattatagccagaaactcattcactattccatcacaacctggc
atacctgaagaagttggggctggcaaagagcacatcatcattcagtggttaaaacctgaa
tctgatggtggcaatgagatcagcaactacctagtggacaaacgtgagaagaagagcttg
cgctggacacgtgtcaacaaagactatgtagtgtatgataccaggctgaaggtgacaggc
ctgatggaaggttgtgattaccagttccgggtgactgcagtaaatgctgctggtaacagt
gaacccagtgaagcttccaactttatctcatgcagagaaccatcatatacccctggacca
ccttctgctccaagagttgtggataccaccaagcacagcattagtttggcatggaccaag
cccacgtatgatggtggtgctgacatcataggatatgttcttgagatgcaagagaaggac
actgatcaatggtaccgagtacataccaatgccacaataagaaatactgaattcactgtg
ccagaccttaaaatgggccagaaatactccttcagagttgctgctgtgaacgtgaagggt
atgagtgaatatagtgaggctgtcgctgaaattgagcccgtggaaagactagaaatacca
gatcttgagcttgcagatgatttaaagaagactgtgaccatcagagctggggcttcatta
cgcctaatggtgtctgtatcgggaagaccacctcccgtcattacatggagcaagaagggc
attgaccttgcaaatcgggcaattattgacaccactgacagctactctttacttattgtg
gacaaagttaaccgatatgatgctggaaaatacaccattgaagctgaaaatcaatctggc
aagaaatcagcaacagttcttgtgaaagtatacgatactcctggtccctgtccttcagtg
aaagttaaggaagtatcaagagattctgtgaccatcacttgggaaatccccacaattgat
ggcggagcgccagtcaacaattacattattgagaaacgtgaagctgccatgagagcattc
aaaacagtaactactaaatgcagcaagacactttaccgaatttctggacttgtagaagga
accatgtactatttcagagtgttgccagaaaatatttatggcattggagagccttgtgaa
acatctgatgcagttctggtctcagaagtgcctttggtgcctacaaaactagaagtgact
gatgtcaccaaatcaacggttacccttgcctgggaaaaaccactctatgatggtggtagc
cgactcactggatatgttcttgaggcctgcaaagctggcaccgagagatggatgaaggtc
gtcaccttaaaacccacagtcttagagcacactgttatttccttaaatgaaggtgaacag
tacttatttagagtaagggcacaaaatgagaaaggtgtgtcagaaccaagagagatcgtc
acagctgtgactgtacaagacctcagagtgttgccaacaattgatatctctacaatgcct
caaaagaccatccacatcccagctggcagaccagtagagctagtgataccaatcgctggt
cgtccacctcctgctgcttcctggttctttgctggttctaaactaaaagaatcagagcgt
gtcactgttgaaactcatacaaaagtagttaaattaaccatccgtgaaaccactatcaga
gatactggagaatatacacttgaattgaaaaatgtaactggaactacttcagagaccatt
aaagttatcattctcgacaagcctggtccaccaactgggcctatcaagattaatgaaatt
gatgctacttcagttaccatttcctgggaaccacctgaattggatggtggtgctccgttg
agtggttacgtggtagaacaacgtgatgcccatcgtccaggatggctgccagtgtctgaa
tcagtgactagaacaacatttaagtttaccagactcactgaaggaaacgagtatgtgttc
cgtgtggctgcaacaaaccgctttgggattggctcttacctgcagtccgaggtcatagaa
tgtcgcagcagcatcaatattccaggacctccagaaacattacagatatttgatgtgtcc
cgtgatggcatgacacttacttggtatccaccagaagacgatggtggctcccaagtgact
ggatatattgtggagcgcaaagaagtgagagcagatcgatgggtccgtgtaaataaagta
ccagtgacaatgacacggtaccgttccactggccttattgaaggcttagaatatgaacac
cgtgtcacagccattaatatgagagggactggaaaaccaagtcgtccttctaaacctgtc
gttgccatggatccaatagctcccccaggaaagccacaaaatccaagagttactgataca
acaagaacatcagtctccctggcctggagtgttccagaagatgaaggaggctctaaagtc
acaggctacttgattgaaatgcaaaaagtagatcaacatgaatggaccaagtgtaacacg
accccaaccaagattcgggagtatacgctaacacatctacctcagggcgctgaatacaga
ttccgtgttctagcttgtaacgctggtggacctggagagcctgctgaggtaccaggaaca
gtcaaagtcactgaaatgcttgaatatcctgattatgaacttgatgaaagataccaggaa
ggtatctttgtaagacaaggtggagtcatcagacttaccattccaatcaaaggaaaacca
tacccaatatgtaaatggaccaaggaaggccaagatattagtaagcgtgctatgattgca
acctctgaaacacacactgagcttgtaatcaaagaagctgtcagggatgattctggcact
tatgacctagttctggaaaacaaatgtggcaagaaggctgtttacatcaaggtcagggtg
ataggaagtcccaatactccagaagggccacttgaatatgacgacatacaagctcgctct
gtaagggtcagttggagaccccctgctgatgatggtggtgccgacatcttaggctacatc
cttgagagacgagaagtgcctaaagccgcctggtataccattgattccagagttcgaggt
acatctctggtggtaaaaggcctcaaagaaaatgtggaataccacttccgtgtttcagca
gaaaaccagtttggcataagcaaacccttgaaatctgaagaacctgtcataccaaaaaca
ccactgaatcctccagagcctccaagcaatcctccagaaatccttgatgtaaccaagagt
tctgtcagcttgtcctggtcccgacccaaagacgatggcgggtctcgagttaccggctac
tacatcgaacgcaaggagacatctaccgacaagtgggtcaggcacaacaagactcatata
acgaccaccatgtacactgtcacagggcttgttcctgatgctgagtatcagttccgcatc
attgcacagaatgatgttggcctaagcgagaccagccctgcttctgagccagttgtttgc
aaagatccgtttgataagccaagccaacccggagaacttgaaattctttcaatatccaaa
gatagtgttactctacagtgggagaaacctgaatgtgatggtggcaaagacatcctggga
tactggattgaatacagacaatctggagacagtgcctggaagaagagcaataaagaccgc
atcaaggacaggcaattcacaataggaggtttgctagaagctactgaatacgaattcagg
gtttttgctgagaatgagactgggcttagcagacctcgaagaactgctatgtctgtaaag
acaaaactaacatctggagaggccccaggagtacgcaaagaaatgacggatgttaccacc
aaattgggcgaagctgctcaactctcatgccagattgttggaaggcctcttcctgacatt
aaatggtaccgatttggtaaggagctcatacaaagccggaagtacaaaatgtcttcagat
ggacgtacacatactctgacagtaatgacagaggaacaagaagatgaaggtgtttatacc
tgcatagctactaatgaggttggagaagtagaaaccagtagtaaacttctcctacaagca
tcaccgcagttccatcctggttacccactgaaggaaaaatattatggggctgtgggttca
acgcttcgacttcacgttatgtacatcggtcgtccagtacctgccatcacttggttccgt
ggccagaaacttttgcaaaactcagaacatactgctattgaaaacactgagcactacact
catctcgtcatgaagaacgtccagcgtaagactcatgctgggaaatacaaagttcagctc
agcaatgttttcggaacggttgatgccattcttgatgtagaaatacaagataaaccagac
aaacccacaggaccgattgtgattgaagctctgttgaagaattctgtggtgatcagctgg
aaaccaccggcagatgatggaggctcctggatcaccaattatgtggtggagaaatgtgag
gccaaggaaggggctgaatggcaattggtgtcttcagccatctcagtgacatcctgtaga
attgtgaacctcacagaaaatgctggctattacttccgggtttcagctcagaacactttc
ggcatcagtgaccccctagaagtctcctcagttgtgatcattaagagtccatttgaaaag
ccaagtgctcctggcaaaccaactattactgctatcacaaaagattcttgtgttgtgtct
tggaagccacctgccagcgatggaggtgcaaagattagaaattactaccttgagaagcgt
gaaaagaagcagaataagtggattgctgtgacaacagaagaaattcgagaaactgtcttt
tcagtgcaaaaccttattgaaggtctcgaatatgagttccgtgtgaaatgcgaaaactta
ggtggggaaagtgagtggagtgaaatatcagaacctgtcactccccaatctgatgtccca
attcaggcaccacactttaaagaggaactgagaaatctaaatgtcagataccagagcaat
gctactttggtctgcaaagtgactggtcatccaaaacctattgtgaaatggtacagacaa
ggcaaagaaatcattgcagatggattaaagtacaggattcaagagtttaagggtggctat
caccagctcatcattgcaagtgtcacggatgatgatgccacagtttaccaagtcagagct
accaaccaagggggatctgtgtctggcactgcctccttggaagtggaagttccagctaag
atacacttgccaaaaactcttgaaggcatgggagcagttcacgctctccgaggtgaggta
atcagcatcaagatccctttcagtggcaaaccagaccccgtgatcacctggcagaaagga
caagacctcatcgacaataatggtcactatcaagttatcgtcacaagatctttcacatca
cttgttttcctcaatggagtggagagaaaagatgctggtttctatgtggtctgtgctaaa
aacagatttggaattgatcagaagacagttgaactggatgtggctgatgttcctgaccca
cccagaggagtcaaagttagtgacgtctcacgagattctgtcaacttaacctggactgag
cctgcttctgatggtggcagcaaaatcaccaactacattgttgaaaaatgtgcaactact
gcagaaagatggctccgtgtaggacaggcccgagaaacacgttataccgtgatcaactta
tttggaaaaacaagttatcagttccgtgtaatagctgaaaataaatttggcctgagcaag
ccttctgagccttcagaaccaaccataaccaaagaagataagaccagagctatgaactat
gatgaagaggtagatgaaaccagggaagtttccatgactaaagcatctcactcttcaacc
aaggaactctatgagaaatatatgattgccgaagatcttgggcgtggtcagtttggaata
gttcaccgttgtgttgaaacatcctcaaagaagacatacatggccaaatttgttaaagtc
aaagggactgatcaggttttggtgaagaaagaaatttccattctaaacattgctaggcac
agaaacatcttatacctccatgaatcatttgaaagcatggaagaattaattatgatcttt
gagttcatatcaggacttgacatatttgaacgcattaacacaagtgcttttgaacttaat
gaaagagaaattgtaagttatgttcgccaagtttgcgaagctcttgagttcttacatagt
caaagtattggacactttgacattagaccagaaaatatcatttaccaaaccagaaggagc
tctaccattaaaatcatagaatttggtcaagcccgtcagctgaagccaggggacaacttt
aggcttctgttcactgctcctgaatactatgcacctgaagtccatcagcatgatgttgtc
agcacagccacagatatgtggtcacttggaacactggtgtatgtgctgttgagtggtatc
aatccattcctggctgaaactaaccaacagatcattgagaacatcatgaacgctgaatat
acttttgatgaagaagcattcaaagagattagccttgaagccatggattttgttgaccgg
ctgttagtgaaagagagaaaatctcgcatgacagcatctgaggcactccagcacccgtgg
ctgaagcagaagatagaaagagtcagtactaaagttatcagaacattaaaacaccggcgt
tactatcacactttgatcaagaaagacctcaacatggttgtgtcagcagcccggatctcc
tgtggtggcgcaattcgatctcagaagggagtgagtgttgctaaagttaaagtagcatcc
attgaaattggcccaatttctgggcagataatgcatgcagttggcgaagaaggaggatat
gtcaaatacatctgcaaaattgaaaattatgatcagtctacccaagtgacttggtacttt
ggtgtcagacagcttgagaacagtgagaaatatgaaatcacctatgaagatggagtggcc
accatgtatatcaaagacatcactaaatttgatgatggtacctacagatgcaaagtcgtc
aatgactatggtgaagacagttcttacgcagagctatttgttaaaggagtgagagaagtt
tatgactattactgccgtagaatcatgaagaaaattaagcgcagaacagataccatgagg
ctcctggaaaggccaccagaattcaccctgcctctctataataagacagcctacgtgggt
gaaaatgtccggtttggagtaactatcactgtccacccagaacctcgtgtaacatggtat
aaatcaggtcagaaaatcaaaccaggtgatgatgataagaagtacacatttgagtccgac
aaaggtctttaccaattaacgatcaacagtgtaactaccgatgatgatgctgaatatact
gttgtggcaaagaacaaatatggtgaggacagctgtaaagcaaagttgacagtaacccca
catccacctccaacagacacaacattaagacccatgttcaaacggctactggcaaacgca
gaatgccaggaaggacaaagtgtctgctttgagatcagagtgtctggcatccccccgcca
acattaaaatgggagaaagatggtaagccactgtcccttgggcctaacattgaaattatc
cacgaaggcttggattattatgctttgcacatccgggatactttgcctgaagacactggt
tattatagggtcacagccacaaacacagcaggatccaccagctgccaggctcacctacaa
gtggaacgcttgaggtacgtcaaacaagaattcaagagtcaagaggagcacgaacggcac
gtacaaaagcagattgacaagacattaagaatggctgaaattctttctggaactgaaacc
gtgccactgacacaggtagcccaagaggctctgagagaagctgcaattctttacaagcca
gctgtaagcaccaagaccgtgaagggggaattccgacttgagacagaagaaaagaaggaa
gagaggaaacttcgtatgccctatgaagtaccagagccacggaagtacaaacagaccatc
atagaagaagaccaacgcattaagcagtttgtgcccatgtctgacatgaaatggtacaaa
aaaatacgtgatcaatttgaaatgcctgggaaaattgacagagttgtacagaaaagaccc
aagcgcatccgcctttcaagatgggaacagttctatgtgacgcctcttcctcgctttaca
gatcaatacagacctaagtggcgtattcccaaactgacccaagacgatcttgaaatggtg
agaccagctcgccggcgtacgccttctccggattatactttctattacagacctagaaga
cgctctcttggtgacatttcagatgaagaattactccttcccattgatgactacctggca
atgaaaagaaccgaggaagagaggctgcgtcttgaagaagagcttgagttaggtttttca
gcttcgcccccaagccgaagccctccacgttttgagctttctagtctgcgttactcttca
ccacaagctcacgtcaaggtggaggaaacaaggaaagacttcagatattcaacctatcac
atcccagcaaaggctgagactagtacaagttacgcagagctgcgggaacggcatgcccag
gcctcatacagacaaccgaaacaacggcaaaggatcatggctgagaaagaggatgaagag
ttgcttcgtccagttacaaccacccagcgtctctcagaatacaaaagcgagcttgaccac
atgtcgaaggaagaaaagtctagaaagaaatcaagacgacaaagagaggtaacagaaata
acagaaattgaggaagaatatgagatcacaaaacgtgctcagagagagtcctcctcatct
gtgtctagactactgagacgacggcggtccctgtctccaacttacatcgaattaatgcgg
ccggtgtcggaactgatccggtcacgtccacaaccagctgaggaatatgaagatgacaca
gaaagaaggtctcctactccagagaggacgcgcccacgttcccccagccctgtgtctagt
gagaggtcactctcaagatttgagaggtcagcaagattcgatattttttccaggtatgag
tccatgaaagctgctttgaagactcagaagacatcagaaagaaagtatgaagttttgagt
cagcagccttttacactggaccatgcccctcgaatcacactgagaatgcgctcccacagg
gtaccatgtggccaaaatacacgttttatcttaaacgttcagtctaagccaactgccgag
gttaaatggtaccacaatggtgtagagctgcaagagagcagtaagattcattacaccaac
acgagtggggtcctgactctggaaattttggactgtcacattgatgacagtggaacatac
cgtgctgtgtgcaccaactacaaaggggaagcttctgactacgcgaccctggacgtaaca
ggaggcgactacaccacctacgcttcccggcgcagagacgaggatgtcccccgatctgtt
tttcctgagctgacgaagacagaggcatatgcggtttcatcgttcaagaaaacatctgag
atggaagcttcctcttcggtcagggaaatgaaatcacagatgactgagacaagggaaagt
ctctcatcatatgaacaccatgcatctgcagaaatgagaagggctgcagtagaagaaaag
tctctggaggaaaaatccacacagagaaagatcaagtcaactttggcagcaagaattcta
accaagccaaggtccttaaccgtctatgaaggcgagtcggcgaggttttcttgcgacaca
gatggtgagccagtgccaaccgtgacctggctgcgtggaggacaagtgatcagtacgtcc
acccaccgccaagtgaccaccacgaagtacaaatcaacctttgagatctcttcagtccag
gcctccgatgagggcagctacagtgtggtggtagaaaacagtgaagggaggcaagaagca
cagtttactctgtctattcaaaagtccagggttactgaaaaggctgtgacgtcgccacca
agggtgaaatccccagagccccgggtgaaatccccagaaggaggtaagcctccaaaacga
gtgaaatccccagaaccagtgacttctcagccaaaagtcgtatcacccacagagacaaaa
cccacgccaacagagaaagttcagcagctgccagtctctgccccaccgaagataactcag
tccctgaaagcagaagctgttaaagatattgcaaagctgacctgtgcagttgaaagtagt
gcattatgtgcaaaagaagtcagctggtataaagatggcaagaaactgaaggaaaatggg
cattatcagtttcattattctgcagatggtacctatgagctcaaaatccagaacctcacg
gaatctgattgcggagaatatgtttgtgaggtttctggtgaaggtggaacttctaaaact
aatttccagtttatgggacaagctttcaagagtatccatgagcaggtgtcaagcatatca
gaaactaagaaatcagctcagaaaactgctgagtcaacagaaaccaagaaatcagctcag
aaaactgctgagtcaacagaaaccaagaaatcagctcagaaaactgctgagtcaacagaa
accaagaaatcagctcagaaaactgctgagtcaacagaaaccaagaaatcagctcagaaa
actgctgagtcaacagaaaccaagaaatcagctcagaaaattgctgagtcaacagaagcc
aagaaaactgaaccaaaagctcctgaaccaatttcctcaaaaccagtaattgttactggg
ctacaggatacaactgtttcctcagacagcattgctaagtttacagttaaagttactgga
gaaccccagccaactgtcatctggacaaaggatggaaaggctattgcacaaggaggtaaa
tataaactctctgaagacaaagaaggattcttcttagaaattcataagactgatacttct
gacagtgggctttatacttgcacagtaacaaattcagctggatctgtgtcctccagctgc
agattaaccataaaagctgtaaaagacgcagagacacagaaagtatctacacagaagacc
tctgaaattacatctcaaaagaaggcagttgtccaagaggaaatttcccaaaaagcctta
atttctgaacaaatcaagatgtcagaggtaaaatctcaagaaaaattatccctcgaagaa
gaagcttcaaaagttatgatttctgaaaaagtcaagaaatcagaagcagcctctatggag
aaatccattgtccatgaggaaatcactaaaacatcacaggcatcagaagaaatcagaact
caagctgaaattaaagcattttctactcagatgaacataactgatggtcagaaagtgact
ttaaaagccaacattgctggcgccactgatgtgaaatgggtactgaatggagtggaactc
gctaactccgaggagtacagatacggtatctcgggcagtgatcagaccctaaccatcaag
caggccagtcacaaagatgaaggaatactcacctgcattggcaaaaccagtcaaggaatc
atcaagtgtcagtacgacttgaccttgagcaaagaactctcaaatgctccagccttcatc
tcacagcccagatctcaaaatattaacgaaggacaaaatgttctattttcttgtgaaatc
agtggtgagccctcccctgaaattgaatggtttaaaaacaacctgccgatttctgtttct
tcaaatatcagcgtaagtcgctccagaaatgtatattctcttgaaatccaaaacgcatca
gtaagtgacagtggaaagtacacaattaaagccaaaaatttccgtggccaatgttcagct
actgcttccttaacggtccttcctctagttgaagagcctcccagagaggtagtattgagg
acaagtggtgacacaagcttgcaaggaagcttctcgtctcagtcagtccaaatgtctgcc
tctaagcaggaggcctccttcagcagtttcagcagcagcagtgctagcagcatgactgaa
atgaaatttgcaagcatgtctgcccaaagcatgtcctccatgcaacagtcctttgtagaa
atgagttccagcagttttatgggaaaatctagtatgacacaactggaaagttcaactagt
agaatgcttaaagcaggcataagaggaattccacctaaaattgaagctcttccctctgac
atcagcattgaggagggcaaagttttaacagtagcctgtgcttttacgggtgagcctacc
ccagaaataacatggtcctgtggtggaagaaaaatccaaaatcaagaacaacaagggaga
ttccatattgaaaacacagatgacctgacaactctgatcatcatggacgtacagaaacag
gatggtggactttataccctgagcttagggaatgaatttggatctgactctgctactgtg
aatataaatattcgatccatttaa

DBGET integrated database retrieval system