KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514754
Entry
107514754         CDS       T06036                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107514754 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107514754 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107514754
NCBI-ProteinID: XP_016008243
Position
Unknown
AA seq 77 aa
MNLRLCVHALLMLWVSLIAVSGGPLMQPSDGKGLKEGTIHHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctgtgtgtgcatgcgctcctgatgctctgggtgtccctaatcgcggta
tctggagggcccctgatgcagccttctgatgggaaggggctaaaggaaggcactatccac
cacctggtgcaacccagagggtcaaggaatggaccagggccctggcagggaggtcggaga
aaattccgccgccagcggccacgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system